KEGG   Legionella pneumophila Lens (serogroup 1): lpl1383Help
Entry
lpl1383           CDS       T00208                                 

Gene name
thrC
Definition
(GenBank) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf00260  Glycine, serine and threonine metabolism
lpf00750  Vitamin B6 metabolism
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
lpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpl1383 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lpl1383 (thrC)
Enzymes [BR:lpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lpl1383 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Ntox44 HBS1_N
Motif
Other DBs
NCBI-ProteinID: CAH15623
Pasteur: lpl1383
UniProt: Q5WWR6
Position
1543420..1544694
Genome map
AA seq 424 aa AA seqDB search
MQMKIRIKSTRGQCISTIDEAILSGLAGDGGLFVPDRFPDLTIKKFYEYGNLIDFSAHLL
SPFFSDSKIDVNNAFFQKFLTFSFPLHYLFKKSYVLELFHGPTLSFKDLGTQFFSECLLH
LIENKSAKVLVATSGDTGAAIAHALHGKRDLEGIILFPKDKLTFRQQSQITCWGENIRAL
AVNGSFDQCQQLVKLVFAKREHKGILTTANSMNIVRLLPQIIFYAFTSIQLALRHNHSVN
FIVPGGNLGNVTACYWAKMLGFPVEQILIANNTNSALGEFLLTGAYQAKSVTKTLATAMD
VGEPSNLERLFVLFNNYSECKKQMNAESVSDEQIKQAILHCYNKYHYIICPHTATAYHRL
STINQDKPWVIVAPGHPAKFEEVLEPLLKKEIPVPEQLKILLGRKQHYSIIEPNYHSLYH
FLVE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
ctgcagatgaaaattagaataaagagtacgagaggacaatgtatctccacaatagacgaa
gcaatactgtcaggcttggcaggggatggcgggttatttgtaccggacaggttccccgat
ttaacaataaaaaaattttatgaatacggtaatttaatcgacttttctgctcatttactc
tcgccatttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctc
accttctcctttccgctgcattatctttttaagaaaagttatgtactcgagttgtttcat
gggccaaccctgtctttcaaagatttaggaactcaatttttcagtgaatgtttattgcat
ctgatagaaaacaagagcgccaaagtcctggtcgcaacatctggtgatactggcgctgcg
attgctcatgctttgcatgggaaaagagatctggaaggaatcattttatttcccaaagat
aaacttactttcagacaacaatctcaaattacttgttggggggagaatattcgtgcattg
gctgttaatggcagttttgatcaatgtcaacagctggtgaagctggtatttgccaaaaga
gaacataaaggaatattgactacagccaatagcatgaatattgtcagattattaccacag
attattttttatgcttttaccagcattcaactggcattaagacataatcattctgttaat
tttatagttccaggcggaaacctgggtaatgttacggcttgttattgggcaaaaatgctg
ggttttccggttgaacaaattttaatagctaataatactaatagtgcactgggcgaattt
ttattaacgggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggat
gtaggtgagccaagcaatttggagcgcttattcgttttatttaataattattctgaatgt
aaaaaacagatgaatgcagaatctgttagtgatgaacaaattaagcaagctatcctacat
tgttacaataaatatcattatataatttgccctcataccgctacagcttatcatcgtcta
agtacaatcaatcaggataaaccctgggttattgtggcaccagggcacccggcgaaattt
gaagaggtattagaaccactattgaaaaaagaaatccctgtcccggaacagctgaagatc
cttttaggcagaaaacaacattattcaatcatagagccaaactatcattctttgtatcat
ttcttagttgaatga

DBGET integrated database retrieval system