KEGG   Legionella pneumophila Lens (serogroup 1): lpl1428Help
Entry
lpl1428           CDS       T00208                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf00071  Fatty acid degradation
lpf00072  Synthesis and degradation of ketone bodies
lpf00280  Valine, leucine and isoleucine degradation
lpf00310  Lysine degradation
lpf00362  Benzoate degradation
lpf00380  Tryptophan metabolism
lpf00620  Pyruvate metabolism
lpf00630  Glyoxylate and dicarboxylate metabolism
lpf00640  Propanoate metabolism
lpf00650  Butanoate metabolism
lpf00900  Terpenoid backbone biosynthesis
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
lpf01130  Biosynthesis of antibiotics
lpf01200  Carbon metabolism
lpf01212  Fatty acid metabolism
lpf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lpl1428
   00630 Glyoxylate and dicarboxylate metabolism
    lpl1428
   00640 Propanoate metabolism
    lpl1428
   00650 Butanoate metabolism
    lpl1428
  09103 Lipid metabolism
   00071 Fatty acid degradation
    lpl1428
   00072 Synthesis and degradation of ketone bodies
    lpl1428
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lpl1428
   00310 Lysine degradation
    lpl1428
   00380 Tryptophan metabolism
    lpl1428
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lpl1428
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lpl1428
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    lpl1428
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpf04147]
    lpl1428
Enzymes [BR:lpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lpl1428
Exosome [BR:lpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lpl1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAH15668
Pasteur: lpl1428
UniProt: Q5WWM5
Position
1594685..1596004
Genome map
AA seq 439 aa AA seqDB search
MKHQSNLSGRNVYVVDGSRTPFLKAKGVGPFCGSDLAVAAGTTLLNRQPFSPDELDEVII
GSAMPGPDEANIARVVALRLGCGDKVPAFTVMRNCASGMQALDNAAIQIATGRSNLVLAG
GTDAMSHAPLLFNEKMASWLANWFAAKSMGQKLALITKFKPSYLAPVIALLRGLTDPIVG
LNMGQTAEKVAYRFNITREQMDEFAAQSHLRIAQAYAENKMSEVSPIIDYKGCIYPQDDG
IRADSTVEKLSKLKPFFDKKYGMVTPGNSSQITDGACLLLLASAEAVKKYALPVLGRIVD
SQWAALDPSQMGLGPVHAATPILERHNLKPQDLDCWEINEAFAAQVLGCLAAWNDEEYCK
TQLGLKEAIGSPSLERLNRDGGAIALGHPIGASGARIVLHVLKSLEQRNESRGMAAICIG
GGQGGAMYLERVTEVKGHE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccagtcgaatttaagtggtcgtaacgtttatgttgtcgatggaagtcgaacg
ccttttcttaaagcaaagggagttggtccattctgtggttcagatttggcagttgctgca
ggaacaactttgctaaatcgtcaaccattttctccggacgagcttgatgaggtcattatt
ggtagcgctatgcctggaccagacgaggccaatatcgctcgcgtggttgctctgcgtttg
ggatgtggtgataaggtgcctgcatttactgtaatgagaaattgtgcgtcaggcatgcag
gcattggataatgccgcaatccaaattgctacagggcgcagtaatttggtcctcgctggt
ggaacagatgccatgagtcatgcaccgttattatttaatgaaaaaatggcttcctggctg
gcaaactggtttgcagctaaaagtatggggcaaaagctggctttaattacaaagtttaaa
ccttcttatctggcaccggtaatcgctttgctcagaggcctgactgatccgatagtagga
ttgaatatgggacaaacagctgagaaagtagcttatcgatttaacatcacaagagagcaa
atggatgaatttgcagctcaaagccatttaagaatagctcaagcttatgctgaaaataaa
atgtctgaagtttccccaattatagattataaaggttgtatatatcctcaagatgatggg
attagggcagattctacggtggaaaaattgtcaaaactaaaacctttttttgacaaaaaa
tatggcatggtcacccctggtaacagttcacagataactgatggtgcctgtttattgcta
ttggccagtgctgaggctgtaaaaaaatatgctttaccggtattaggtcgaatagttgat
tcacaatgggctgctctagatccctctcaaatgggtctgggtcctgttcacgcggcaacc
cctatattagaaagacataatttaaagccacaagatttggattgttgggaaatcaatgag
gcctttgccgcccaagtcttagggtgtttggctgcatggaacgatgaagaatactgcaaa
acacagcttggccttaaggaggcaattggatcgccgtccctggagcggctcaatcgggat
ggaggagcaattgcgttaggtcatcctattggtgccagtggggctcgtattgtattgcac
gttcttaaatctttagagcaaagaaatgagtcgcgaggtatggcagcaatttgtatcgga
ggtggtcagggaggagctatgtatcttgaacgagttactgaggtgaaaggacatgaataa

DBGET integrated database retrieval system