KEGG   Legionella pneumophila Lens (serogroup 1): lpl1772Help
Entry
lpl1772           CDS       T00208                                 

Gene name
hemB
Definition
(GenBank) hypothetical protein
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf00860  Porphyrin and chlorophyll metabolism
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    lpl1772 (hemB)
Enzymes [BR:lpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     lpl1772 (hemB)
Exosome [BR:lpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lpl1772 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: CAH16011
Pasteur: lpl1772
UniProt: Q5WVP3
Position
1979173..1980168
Genome map
AA seq 331 aa AA seqDB search
MIKYNLPLRLSRLRKNAMSRALVRETRLHTQQLIAPLFISEYLTEAKEISAMPGQFQLGL
NCIPEEIESLSKLSIPAVLLFGIPKQKDACGSESMNNNGIIQQAIKKIKSVNSDMLVITD
LCFCEYTDHGHCGVLDGSQINIASTLELLGKQAVSHAEAGADWVAPSGMTDGMVLAIRQA
LDTASFHEIPILSYSAKYCSCLYGPFREAAQGAPQFGDRKAYQMDPANSEEAVRETRLDL
EEGADMIMVKPAGFYLDIIYKLKQHFADVPLCAYQVSGEYSMIKNAAKNNLIHEEQAMTE
SLIAIKRAGADFIISYFAKGMAELLNSQNFI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatataatttgcctttaagattatctcgtttaagaaaaaatgccatgtcaaga
gcattagtaagagagacgaggctgcatacacaacaactgattgctccattgtttattagc
gaatatttaactgaagcaaaagaaatcagcgctatgccaggccaatttcaactaggcctc
aattgtatacctgaggaaattgaatctttatcaaaactaagtatccctgcagtcctctta
ttcggtatccctaagcaaaaagacgcttgcggcagtgaatcaatgaataataatggaatc
atccaacaagcgatcaaaaaaattaaatccgttaatagtgacatgttagtgatcactgat
ctttgcttttgcgaatacaccgatcatggtcattgcggggttctggatggtagtcaaatt
aatatcgcttctaccttagagttattaggaaaacaagcagtaagtcacgctgaagcaggt
gctgattgggttgcccccagtggtatgacagacggaatggttttagctatacgccaagca
ctggatactgcctcatttcatgaaattcctattttaagttacagtgccaaatattgctcg
tgcctttatgggccttttagagaggccgcgcaaggtgcacctcagtttggcgataggaaa
gcgtatcaaatggatccggcaaacagtgaagaagctgtaagagaaacccggttagacctg
gaagaaggcgctgacatgattatggttaaaccggccggtttttatcttgatattatttat
aaacttaaacaacattttgccgatgtaccgctttgtgcctatcaggtcagcggtgaatat
tcgatgataaaaaatgcagcaaaaaataatctaatccatgaagaacaagcaatgactgaa
agtctcattgcgattaaacgtgctggcgctgattttattatttcttattttgctaaaggc
atggctgagttattaaactctcaaaattttatttaa

DBGET integrated database retrieval system