KEGG   Legionella pneumophila Lens (serogroup 1): lpl1987Help
Entry
lpl1987           CDS       T00208                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf00230  Purine metabolism
lpf01100  Metabolic pathways
Module
lpf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lpl1987 (gmk)
Enzymes [BR:lpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     lpl1987 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MobB AAA_33 NTPase_1 Glyco_transf_5 AAA_16 AAA_22
Motif
Other DBs
NCBI-ProteinID: CAH16227
Pasteur: lpl1987
UniProt: Q5WV30
Position
complement(2227841..2228470)
Genome map
AA seq 209 aa AA seqDB search
MVSDNSGNLYIVAAPSGGGKTSLVKKLIEMVGEIEVSVSHTTRPMRPGEKEGVDYFFIDE
EQFISMVNEGAFIEHAKVFNHWYGTSVAQINKRLQFGIDVVLDIDWQGAEQIRHAYPDAV
SVFIIPPSLDALKERLMNRRQDKDNVISERMTKAQDELGHYPEFDYLIVNDDFEKAAMEL
QSIVIANRLRIEKQANKQAKLLSFLLSSQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggttagtgataattcaggaaatttatacattgttgcagcaccctccggaggagggaaa
acaagtttggtgaaaaaactcattgaaatggtgggtgagattgaagtgtcagtttctcat
acgaccagacctatgagacctggagaaaaagaaggggtggattattttttcattgatgag
gaacaatttatttctatggtgaatgagggggcgtttattgagcatgccaaagtatttaat
cattggtatggtacctcagttgctcaaattaacaaacggttacaatttggaattgacgtc
gttcttgatattgattggcaaggagcggagcaaattagacatgcctatccggatgcagtg
agtgtatttatcattcctccttctttagacgcattaaaagaacgcttgatgaacaggcga
caagataaagataatgtgattagtgagagaatgaccaaagcacaggatgaacttggccat
tatcctgaatttgattatctgattgttaatgatgattttgaaaaggcggcaatggaatta
cagtcgatagtaattgccaataggcttcgtattgaaaaacaggcaaataaacaagccaaa
ttgctttctttcctcttgtcatcgcagtaa

DBGET integrated database retrieval system