KEGG   Legionella pneumophila Lens (serogroup 1): lpl2661Help
Entry
lpl2661           CDS       T00208                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthetase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf00860  Porphyrin and chlorophyll metabolism
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    lpl2661 (hemD)
Enzymes [BR:lpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     lpl2661 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CAH16902
Pasteur: lpl2661
UniProt: Q5WT64
Position
3032075..3032827
Genome map
AA seq 250 aa AA seqDB search
MTKSLNGLRILNTRPREQAEVLNKKIIESGGIPIDCPTMEIVASETNWINKLPDLTSVNQ
AIFVSGNAVRYFMMELASKRINWPNSIRVAAIGKGTSRVLNEFNIQVRDVPELPDSEHLL
TLNSLQQIRNQTILLVKGEGGRQLIEEYLMLKGAKLCILSVYKRVMPAIDQEFLNSLWRD
DLADIILLTSEQSIHNLFKMFSIEGQMWLQNKPCLVISDRLAKVASLFGIKKILISHPER
MIGTLFDYKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatcacttaatggtcttcgcatattaaataccaggccaagggagcaagcagaa
gtactaaataaaaaaattatcgagtctggcgggatacccatcgactgccctacgatggaa
atagtggcgtctgagaccaattggataaataaattgcctgatttgacctcagtaaatcag
gcaatttttgtcagtggaaatgcagttcgttatttcatgatggaactggcttccaaaaga
atcaattggcctaatagcatccgggtagctgctataggtaaaggcacctccagagtactc
aatgaattcaatatccaggttagagatgtccccgaattacctgacagcgagcatttattg
actctcaattcgctgcaacaaataagaaatcagacgattctgcttgtgaaaggagaagga
ggcaggcaactgattgaagaatatttaatgctgaagggagcaaagctatgtattctatca
gtctataaacgagtcatgccagccatcgaccaagaatttcttaattctctgtggcgcgat
gacctggcggacattatactgttaacaagtgagcagtccatacataatctttttaaaatg
tttagcatagaggggcaaatgtggttacaaaacaaaccttgcctggtcattagtgaccga
cttgcaaaggtagcttctttatttggaattaaaaagattcttattagccatccagaaagg
atgataggtacgttatttgactataaggattaa

DBGET integrated database retrieval system