KEGG   Legionella pneumophila Lens (serogroup 1): lpl2831
Entry
lpl2831           CDS       T00208                                 

Definition
(GenBank) hypothetical protein
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-ProteinID: CAH17075
Pasteur: lpl2831
UniProt: Q5WSP6
Position
complement(3231606..3232502)
AA seq 298 aa
MKDKTIPSPDAKSFNKKEFSENVAKGAIVGATSTTMTFGLFDKPLAIATKASSEVAQHPW
RGIKSLFAGALNGSFSTSWNNSLYAQAYRAYLEHPVKGYPVALLNSCLKNVVFFPAKYGS
ERALYALSGNEQQAKNYSGFLAGLMTVYLTAPISVVKARLMTNVPLNTLSLKRLGSGVNA
IAMRDCIQYGIYFNAKERLNEKIGDGVMAGGIAGIVGYVFSNPLSVIGLNQKTAVESVNI
PNMAKRIYQANGVKGFYPLVGLAAWGMFARGVAIHQGTKLYESLQEKEAYGRPTRNRE
NT seq 897 nt   +upstreamnt  +downstreamnt
atgaaagacaaaacaatacccagccctgatgcaaaatcatttaataagaaagagttctct
gaaaacgtggcaaaaggagccattgttggcgcaaccagcacgaccatgacatttggttta
ttcgacaagcccttggccattgctacgaaagcctcctcggaagtggctcagcatccatgg
cgtggtatcaaaagtttgtttgccggggcactgaacggaagtttttcgaccagctggaat
aatagcctgtatgcacaggcttatcgagcttatttagagcatcctgtcaaaggttatcct
gttgctcttttaaattcctgcctaaagaatgtggtattttttcccgcaaaatatgggagt
gaaagggcgctttatgcgctttcagggaatgaacagcaagcaaaaaattattccggattt
ctggccgggctcatgaccgtttacctcactgcacctatttctgttgtgaaagcaagactg
atgactaacgtaccccttaatacgcttagtttaaaacgattgggctcaggcgtgaatgcc
atcgcgatgcgtgactgcattcaatatggaatttattttaatgccaaagagcggttaaat
gaaaaaattggtgacggtgtcatggcgggtggcatagctggcattgtggggtatgtcttt
agtaatcccttaagtgtgattggactcaatcaaaaaacggctgttgaatcagtaaacatt
cccaacatggcgaaacgaatttatcaggcgaatggtgtgaaagggttttatcctttagtc
ggcctggccgcttggggcatgtttgctcgtggcgtggctatccatcagggcaccaaacta
tacgaatccttacaggaaaaagaagcttatggaaggccaacaaggaacagggagtaa

DBGET integrated database retrieval system