KEGG   Legionella pneumophila Lens (serogroup 1): plpl0026
Entry
plpl0026          CDS       T00208                                 
Name
(GenBank) hypothetical protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpf02044]
    plpl0026
Secretion system [BR:lpf02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   plpl0026
SSDB
Motif
Pfam: TraF Mito_carr
Other DBs
NCBI-ProteinID: CAH17345
Pasteur: plpl0026
UniProt: Q5WRY2
Position
pLPL:23503..24243
AA seq 246 aa
MINRMLIVFLLLSGVAFADKPVGFLWYTKERETKRVEKKTSGIPFKSLSYTERDAVLRFY
TMEALHKARYTKKMEDMRVFLSLQDYWLKESSRFKSLFQKTMLAHPEYDYAVTHPTSNLG
AKITDEVRESQTIEVINRLSKSHGLLFFYRGKSPYDLKQIPIIVDFCKRFRIQLIPVSVD
GATSPELLNSRMDQGQANRLGVRYFPALLLVNPASQQVSPVAYGLTTQDVLMERIKQVVN
QFKGEE
NT seq 741 nt   +upstreamnt  +downstreamnt
atgattaataggatgctaattgtttttttgctacttagtggggttgcgtttgctgataaa
ccggtgggttttctatggtatacaaaagaaagggaaacaaaaagagtcgagaaaaaaacc
tcgggtattccttttaagagtctaagctatacagagcgcgatgctgttctgcgcttctac
accatggaagcgcttcataaagcacggtacaccaaaaagatggaggacatgcgcgtattt
ttaagtctgcaagattactggcttaaagagtcctcccgatttaagtcattgtttcagaaa
acgatgttggcacatccagaatatgattatgcagtgactcatccgacttctaatctgggc
gcaaaaatcaccgatgaggtgcgcgaatcccaaaccatagaagttataaaccgcttgtcc
aaatcacatggcttgttgtttttttatcgtggaaaaagcccttatgacttaaagcaaata
cccattattgttgatttttgcaagcgatttcgcattcaactgatcccagttagtgttgat
ggcgcaacctctcccgaactgctgaattctcgaatggatcaagggcaagctaatcgattg
ggtgttcgttattttccagcactgctgttggtgaatcctgcaagccaacaggtttcacct
gtggcatatggcttaactacgcaggatgtcttgatggaacgtataaaacaagtggtcaac
caatttaaaggagaggaataa

DBGET integrated database retrieval system