KEGG   Lactobacillus pentosus: BB562_00605Help
Entry
BB562_00605       CDS       T05251                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
lpg  Lactobacillus pentosus
Pathway
lpg00561  Glycerolipid metabolism
lpg00640  Propanoate metabolism
lpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BB562_00605
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BB562_00605
Enzymes [BR:lpg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BB562_00605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase baeRF_family7
Motif
Other DBs
NCBI-ProteinID: AUI77295
UniProt: A0A2K9HXY6
Position
complement(135895..137031)
Genome map
AA seq 378 aa AA seqDB search
MSEDLMFVSPDKYIQGAGLLEHSASYINALGSHPLIMADALIWKIVGEDFATYLSQHDFD
VTRVTFNGEASVQEIARITQIAKDNHNDIIIGLGGGKTLDTSKGIAEEVGAKLVIAPTAA
SADAPTVGLSVLYTEEGSFDQYKFYQRHSDLVLMDTQVIANAPVRTLISGIADAMATNIE
AKATAQSHGTTMGNGAATFTGRAIAAECERVIWKYAYEAVESNVQHIVTPALDAIVEANT
LLSGLGFENGGLAAAHAIHNGFTAVKGDVHHLTHGEKVAFGTMVELVLQGTSHEELNRYI
EFYLTLGLPITLEATHLDQLSDEEMLQIGKMATMPDETMKNMPFKVTPREVVNAMKAAST
FAHTYEATHTIKPILPAK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagatttaatgtttgttagccccgataagtatattcaaggtgccggactcttg
gaacattcagcaagctatatcaacgccctcgggagccatccgttgatcatggccgacgcg
ctgatttggaaaatcgtcggtgaagacttcgcgacttacttgagccaacacgattttgac
gtcacacgggtcacctttaatggtgaagcctcagttcaagaaatcgcgcggatcacacag
attgccaaggataaccataacgatattattatcggtctcggcggcggcaagactctcgat
actagtaaagggatcgctgaagaagtgggtgccaagttagtcatcgcgccgactgcggct
tcagcggatgcaccaaccgtgggcttatcagtgctctatactgaagaaggtagcttcgac
caatacaagttctaccaacgtcacagcgacttagtcttaatggacacacaagtcatcgct
aacgcgccagtccggacactcatctctgggattgctgacgcgatggccactaatattgaa
gcaaaggcgaccgcgcaatcccacggcacaacgatgggcaacggtgctgctacctttact
ggtcgggcaattgcggccgaatgtgaacgtgtcatttggaagtacgcctatgaagccgtg
gaatccaacgtccaacacattgtaacaccggcacttgacgccatcgtcgaagccaacacc
ctactctctgggctcggatttgaaaatggtggtttagcggctgcccacgccattcataat
ggcttcaccgccgttaagggcgacgtccatcatttgactcacggcgagaaagtggccttt
ggtaccatggttgaactcgtattacagggtacttcacacgaagaactcaatcgctacatt
gaattctacttgacccttggcttaccaatcacgctagaggcgacccatctcgatcaatta
tccgatgaagaaatgctgcaaattggtaagatggcgacaatgcctgacgaaaccatgaag
aacatgcctttcaaagtcaccccacgcgaggtggtcaacgccatgaaggctgcatcgacc
ttcgcccacacttacgaagccacccatacgatcaaaccaatcttgccggctaagtaa

DBGET integrated database retrieval system