KEGG   Lactobacillus pentosus: BB562_11625Help
Entry
BB562_11625       CDS       T05251                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lpg  Lactobacillus pentosus
Pathway
lpg00970  Aminoacyl-tRNA biosynthesis
lpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BB562_11625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lpg03029]
    BB562_11625
Enzymes [BR:lpg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BB562_11625
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BB562_11625
Mitochondrial biogenesis [BR:lpg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BB562_11625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AUI79280
UniProt: A0A2I0Z4Y9
Position
complement(2539518..2540942)
Genome map
AA seq 474 aa AA seqDB search
MNFVTTIGLEVHVELKTNSKIFSPSPVQFGSEPNANTNVIDWGYPGVLPTPNKGVVEAGI
KAATALHAQIEHHTYFDRKNYFYPDNPKAYQITQHEKPIAHDGWIEIEVDGKKKKIGIEE
MHIEEDAGKNTHENDYSYVDLNRQGTPLIEIVSKPDIASPEEAYAYCEALRQRIQFTGVS
DVKMEEGSMRVDVNISIRPAGSDKYGVKTEMKNLNSFNYVRKSLEYEEKRQQQVLMSGGK
IQQETRRFDETTGETILMRVKEGSDDYRYFPEPDIPAVNIDDDWISAVKATIPEMPGSRR
ERYVNEFGLTAYDAGVLTQTKEMSDFFDDTVAQGADPKLASNYLQGDVNAYLNEHKVDLS
ATELTPEHLADMIKMITDETISSKIAKKVFKAIMAGSEPVQWVNDKGLVQLSDPAKLQPI
VDDVLDNNQQSIDDFKNGKDRAVGFLVGQIMKKTRGQANPKVVNQLLMTSLKAR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgtaaccacgattggtttggaagtccacgttgaattaaaaacgaattccaaa
atctttagtccttcacccgtgcaatttggttccgaaccaaatgccaacaccaacgtgatc
gactggggatatcctggggtactgccaacaccgaacaagggcgttgtcgaagccggaatc
aaggctgcaactgccttacacgcacagatcgagcaccatacgtactttgaccgtaaaaac
tacttctatccagataaccctaaggcctaccaaattacgcagcatgaaaagccaattgcg
catgatggttggatcgaaatcgaagttgatggcaagaagaaaaaaatcggtatcgaagaa
atgcatattgaagaagatgccgggaagaacacccacgaaaatgactattcctatgtcgat
ttgaaccggcaagggacgccattgatcgaaatcgtttcgaagcctgatattgcgtcacca
gaagaagcttatgcttactgtgaagcattgcggcaacggattcaatttaccggtgtttcg
gatgttaagatggaagaagggtccatgcgggtcgacgttaacatttcgattcggccagca
ggttcggataagtacggtgtgaagaccgaaatgaagaacttgaactccttcaactatgtc
cgtaaatcgttggaatacgaggaaaagcggcaacaacaagtcttaatgtctggcggcaag
attcaacaagagacacgtcggtttgacgaaacgactggcgaaacgattttaatgcgggtc
aaggaaggtagcgatgattaccgttacttcccagaacctgatattccagccgtcaacatt
gacgatgattggatttcagcggtcaaagccacgattccagagatgcctggttcacggcgc
gaacgttacgtcaacgaatttggtttgacggcctatgacgcgggtgttttgacgcagact
aaggaaatgtcggatttctttgacgacacggtcgcacagggtgccgatcctaagttagct
tcgaactacttgcaaggggacgtcaacgcctacttgaacgagcacaaggtcgacttgtca
gcgactgagttaacgccagaacatttggcggacatgattaaaatgattaccgacgagacg
atttcaagtaagatcgccaagaaggtcttcaaagcaatcatggctggttcagaacccgtc
caatgggtcaatgacaagggcttagtccaattgtcagatccagctaagttacaaccaatc
gttgatgacgtattggacaacaaccaacaatcaatcgacgactttaagaatgggaaggac
cgggctgtcggcttcctcgtgggtcaaatcatgaagaagacgcgtggtcaggccaacccg
aaagtggtcaaccaattattaatgacgtcattaaaagcacgataa

DBGET integrated database retrieval system