KEGG   Lactobacillus pentosus: BB562_11635Help
Entry
BB562_11635       CDS       T05251                                 

Definition
(GenBank) asparaginyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
lpg  Lactobacillus pentosus
Pathway
lpg00970  Aminoacyl-tRNA biosynthesis
lpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BB562_11635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lpg03029]
    BB562_11635
Enzymes [BR:lpg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BB562_11635
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BB562_11635
Mitochondrial biogenesis [BR:lpg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BB562_11635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln V-ATPase_C
Motif
Other DBs
NCBI-ProteinID: AUI79282
UniProt: A0A241RLY7
Position
complement(2542405..2542725)
Genome map
AA seq 106 aa AA seqDB search
MAEERINAEQVQHVASLAKLEFTPDQLAMFTPQLEKIIGMFEELSKVDTTGVPVTSRMSD
HTNTLREDVAVKSDEELREALLKNAPETANGLIKVPAIIDESGDGE
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaacggattaatgccgaacaagtccaacacgttgccagtttggcaaaattg
gaatttacaccagaccaactggcgatgtttacaccccaattggaaaaaatcatcggcatg
ttcgaagaattgagcaaggttgatacgactggcgttcccgtgacgtcacggatgagtgac
cataccaatacgttacgtgaggacgtggcggtcaagagtgatgaagaactacgggaagcg
ttattgaagaacgcgccagaaacggccaatggcttgatcaaagtgccagcaattattgat
gaaagtggggacggtgaataa

DBGET integrated database retrieval system