KEGG   Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1): LPV_1863Help
Entry
LPV_1863          CDS       T02174                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1)
Pathway
lph00330  Arginine and proline metabolism
lph00332  Carbapenem biosynthesis
lph01100  Metabolic pathways
lph01130  Biosynthesis of antibiotics
lph01230  Biosynthesis of amino acids
Module
lph_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lph00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LPV_1863 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LPV_1863 (proB)
Enzymes [BR:lph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LPV_1863 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Ntox46
Motif
Other DBs
NCBI-ProteinID: CCD08992
Position
complement(1876327..1877397)
Genome map
AA seq 356 aa AA seqDB search
MKIIIKVGTQSILSVDGNPIYSVLNNLVNQIIYLKNLGHQVILVSSGAVGSGRKIAKNSL
GKTYGDTVGEKQLLASIGQPELMNLYSRLFKNENILVSQLLLTKQDFHTRQHYLNIARLL
TELLKHQNIIPIVNENDSVAIEELMFTDNDELAGLIAAQINADYLILLTNVDGVFTSHPN
DPESKLINTIDPNSGWPNVSAVKSKLGRGGMVSKLDTARKMAGLGINTVIANVNAESIVP
KILNREAVGTIILASKRKSSIKRWIAFSHRTSLPSIIINDNLITLLRNGNRVMSILPIGI
EDFRGECKKGDLIDILNSNNEKIGVGIARYDFLRLKDYLRLQNKPAFIHYDQLHIL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattataaaagtcggaacacaaagtattttatcggtcgacggaaatccaatc
tattccgtactaaataatcttgtaaatcaaattatttatttaaagaacctggggcatcag
gtcattttagtaagctctggggctgtgggctctggtcgaaaaatagctaagaactctctg
ggaaaaacatatggcgatacagtgggagagaagcaactcttggcttcaataggccaaccc
gaactgatgaatctctattctagattgtttaaaaatgaaaacattttagtatctcagtta
ttacttaccaaacaagacttccatactagacagcattatttaaatattgcccgtttatta
acggaattgctaaagcatcaaaatattatccctattgttaatgaaaatgattcggtagcc
attgaagaattaatgtttaccgataatgatgaattagcaggacttattgcagctcaaatt
aatgctgattatctaatactcttaaccaatgtcgatggtgtgtttacatcccatcccaat
gatcctgaatcaaaactcattaatacaattgatcccaattcaggttggcctaatgtctct
gctgtaaaatcaaaattaggtcgaggtggtatggtatccaaactggatactgccagaaaa
atggctggtttaggtatcaatacagtgatcgcaaatgtaaatgcagaatccattgttcca
aaaattctaaatagggaagcagttggaaccataattcttgctagtaaaagaaaatccagt
ataaaaagatggattgcttttagtcatagaacttccttaccatctataataattaatgat
aatttaattactttattacgaaatggtaatcgtgtaatgagcattttaccaatagggata
gaagattttcgtggagaatgcaaaaaaggggatttaattgatatccttaattccaacaat
gaaaagataggagttggaatcgccaggtatgatttcttaagattaaaggactatcttagg
cttcaaaataagcctgcatttatacattacgatcaattgcatattctatag

DBGET integrated database retrieval system