KEGG   Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1): LPV_2097Help
Entry
LPV_2097          CDS       T02174                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1)
Pathway
lph00071  Fatty acid degradation
lph00072  Synthesis and degradation of ketone bodies
lph00280  Valine, leucine and isoleucine degradation
lph00310  Lysine degradation
lph00362  Benzoate degradation
lph00380  Tryptophan metabolism
lph00620  Pyruvate metabolism
lph00630  Glyoxylate and dicarboxylate metabolism
lph00640  Propanoate metabolism
lph00650  Butanoate metabolism
lph00900  Terpenoid backbone biosynthesis
lph01100  Metabolic pathways
lph01110  Biosynthesis of secondary metabolites
lph01120  Microbial metabolism in diverse environments
lph01130  Biosynthesis of antibiotics
lph01200  Carbon metabolism
lph01212  Fatty acid metabolism
lph02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPV_2097 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    LPV_2097 (atoB)
   00640 Propanoate metabolism
    LPV_2097 (atoB)
   00650 Butanoate metabolism
    LPV_2097 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LPV_2097 (atoB)
   00072 Synthesis and degradation of ketone bodies
    LPV_2097 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPV_2097 (atoB)
   00310 Lysine degradation
    LPV_2097 (atoB)
   00380 Tryptophan metabolism
    LPV_2097 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPV_2097 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPV_2097 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LPV_2097 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lph04147]
    LPV_2097 (atoB)
Enzymes [BR:lph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPV_2097 (atoB)
Exosome [BR:lph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPV_2097 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCD09213
Position
2148776..2149960
Genome map
AA seq 394 aa AA seqDB search
MEHNDVVIVAAKRTPMGAMLGNLSALSSPELGAVAHMAALSQSGIAPAEIDEVISGCVLQ
AGIGQAPARQAAIKAGIPNSTGATTINKMCGSGMKAVMLAHDLIKAGTANVILASGMESM
SNAPYLLSKARAGYRLGHGELKDHMFLDGLEDAYDKGQLMGCFAETTAKHFNFSREQQDE
YALRSMTKALKAIENGAFREEIAPVTLTTRKGDITVDVDEGPETAKLAKIPQLKPAFQAD
GTVTAANSSSISDGAASLILMSASNAEKRGIKPLAKIIAHASHSQAPQWFTTAPVDAIRK
VMNKASWKQDDVDLFEINEAFAVVAMAAITQLELNPEQVNIHGGACALGHPIGASGARIL
VTLMHALKHQGKKRGIASLCIGGGEATAMAIELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaacataatgatgtcgtgatagtcgcagcaaaaagaacaccaatgggagctatgcta
ggcaatttatctgcactttcctccccagagttaggggcagtagcgcatatggcagcgttg
tctcaatcaggtattgctccggcagaaatcgatgaagtgatcagtggttgtgtattacaa
gctggtattggtcaagctcctgccagacaggcagcaataaaagcaggcatacctaattcg
acaggagccacgaccattaataaaatgtgtggttcgggcatgaaggctgtgatgcttgcg
catgatttaattaaggcaggtacagctaatgtaattttggctagcggtatggaaagtatg
agcaatgccccctatttattatccaaagcacgagcaggatatagactgggtcatggtgaa
ctgaaagatcatatgttccttgatggattagaagatgcctatgataaaggacaattaatg
gggtgtttcgctgaaacaactgcaaaacactttaatttcagcagagaacaacaagacgaa
tatgccttacgctcaatgaccaaagcgctaaaagcaatagagaatggtgcctttcgagaa
gaaatcgctcctgtcaccttaactacccgcaaaggagatatcacggttgacgtcgatgaa
gggcctgagacagccaaacttgccaaaatacctcagttaaaaccagcctttcaagcagat
ggtacagtcacagcagccaattcaagttctatttcagatggcgcggccagtttaatttta
atgagtgcctcaaacgcagaaaaacgtggcattaagcccttggcaaaaatcatagcacat
gccagccattcccaagccccacaatggttcacaaccgctcctgttgatgcaatccgtaag
gtaatgaacaaagcgtcatggaaacaagatgatgtggatctttttgagattaatgaagcg
tttgcagtagtagcgatggcagcaattactcagcttgaattgaacccggaacaagtcaat
atacatggcggggcatgcgctttagggcatcccattggtgcttcgggagctcgcattctg
gttactttaatgcatgcgctaaaacaccagggtaaaaaacgcggaatagcttctttatgt
ataggcggtggtgaagcaacagctatggcaattgagctaatttaa

DBGET integrated database retrieval system