KEGG   Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1): LPV_2553Help
Entry
LPV_2553          CDS       T02174                                 

Definition
(GenBank) glutathione S-transferase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1)
Pathway
lph00350  Tyrosine metabolism
lph00643  Styrene degradation
lph01100  Metabolic pathways
lph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lph00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    LPV_2553
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    LPV_2553
Enzymes [BR:lph01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     LPV_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: CCD09625
Position
2655471..2656109
Genome map
AA seq 212 aa AA seqDB search
MILYDYFRSTACYRVRITLNLKKIVYEKIEVHLVNNGGEQHSLQYHQINPQELVPSLDIN
GHILSQSMAIIDYLEEVYPEIPLLPKDPFMKANLKSLALIVACDLHPLNNLRVLNRLKEQ
FRASQEQVLEWYHHWLKTGFDAFEEKLGTMKRDKPVCLGSEVSLADVCLIPQVYNAQRFH
FDMASYPIINQINEYCLTLPAFHDAAPEAISS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatattgtatgactatttccgctctaccgcatgctatcgagtaagaatcactcttaat
ttaaaaaaaattgtttacgaaaaaattgaagtgcatctggttaataatggaggcgaacag
catagccttcagtatcatcaaattaaccctcaagaacttgttcccagcctcgacatcaat
ggacatatcttgagccaatcaatggcaatcattgattatctggaagaagtctacccggaa
ataccattgcttcctaaagatccctttatgaaagccaatctaaaatctctggctttaatt
gttgcttgtgatctgcaccccctcaataatttaagagtgttgaatcgcttaaaggagcaa
tttagagccagtcaagaacaggtactggaatggtatcatcattggttaaaaacaggcttt
gatgcttttgaggaaaaactgggaactatgaagcgtgacaagccagtctgccttggaagt
gaggttagtctggcagacgtttgtttgatcccccaggtttacaatgcccaacgatttcat
tttgatatggcgagttacccaataatcaatcaaatcaatgagtattgtctaaccctgccg
gcattccatgatgcggcaccagaagccatttcatcttaa

DBGET integrated database retrieval system