KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_01061Help
Entry
LBPG_01061        CDS       T02808                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
lpi00071  Fatty acid degradation
lpi00072  Synthesis and degradation of ketone bodies
lpi00280  Valine, leucine and isoleucine degradation
lpi00310  Lysine degradation
lpi00362  Benzoate degradation
lpi00380  Tryptophan metabolism
lpi00620  Pyruvate metabolism
lpi00630  Glyoxylate and dicarboxylate metabolism
lpi00640  Propanoate metabolism
lpi00650  Butanoate metabolism
lpi00900  Terpenoid backbone biosynthesis
lpi01100  Metabolic pathways
lpi01110  Biosynthesis of secondary metabolites
lpi01120  Microbial metabolism in diverse environments
lpi01130  Biosynthesis of antibiotics
lpi01200  Carbon metabolism
lpi01212  Fatty acid metabolism
lpi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBPG_01061
   00630 Glyoxylate and dicarboxylate metabolism
    LBPG_01061
   00640 Propanoate metabolism
    LBPG_01061
   00650 Butanoate metabolism
    LBPG_01061
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LBPG_01061
   00072 Synthesis and degradation of ketone bodies
    LBPG_01061
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBPG_01061
   00310 Lysine degradation
    LBPG_01061
   00380 Tryptophan metabolism
    LBPG_01061
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBPG_01061
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBPG_01061
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBPG_01061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpi04147]
    LBPG_01061
Enzymes [BR:lpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBPG_01061
Exosome [BR:lpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBPG_01061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: EEQ65612
Position
complement(1817363..1818544)
Genome map
AA seq 393 aa AA seqDB search
MEEVVILSAKRTPIGKLGGDLAGASAVDLGVAAAQAAIKAARIDPALLNQAIFGNVMQAG
SGQNVARQIGLKSGMATSSTAMTVNEVCGSGLKAVRLGQAAIQLGEADAVLVGGTESMSQ
VPYYAEAVRSGHKFGDTTLVDGLSRDGLNDAFSQQPMGITAENVATQFNVSRQEQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTIAARHGDVIVDRDSAIRPDTSLAKLAQLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATVTGFAEVGIDPAIMGYAPKLAIDKIL
QATGGSIAAIDQIELNEAFASQSVAVARDLGLKDEQFNINGGALALGHPLGASGARILIS
LLYDLAERNQRQGIAALCVGGGIGIAMQIAMHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtgattctaagtgccaaacggacgccgattggtaagttgggtggtgat
ttggctggcgccagtgccgttgatttaggggttgcggcagcgcaggcggcaattaaggct
gcacgaattgacccagcgttactcaatcaggcgatctttggtaatgtcatgcaggctggt
tctgggcagaatgttgcccgacaaatcggattaaaaagcggtatggccactagcagcacg
gcgatgactgtcaatgaagtctgcggctcaggcctgaaggcagtgcggcttgggcaagct
gccattcaactcggcgaggctgacgcggtgcttgtgggcggtaccgaaagcatgagtcaa
gtaccttattacgccgaagcggttcgttcaggccacaaatttggtgatacaacgctggtc
gacggtttgagtcgcgatggattaaatgatgccttcagtcagcagccaatgggaatcacg
gcggaaaatgtggcgacacaatttaacgttagtcgtcaggagcaagatgagtttgctctt
cgttcgcatttacgcgccgcggccgccgcagctgagggtcggtttaagagtcagatcgcc
ccagtgacgattgctgcccgtcacggggatgtcatcgtagatcgtgattcagccattcgg
cccgatacgtcattggctaaattagcccaattaccgcctgtttttgaagtcggcggtact
gttacagcaggtaacgcaagcggcattaatgatggcgcagccgccttgatcctgatggca
aaatcgaaagccgaacaactggggctccattatttagcgacggtcactggttttgccgag
gtgggtattgatccggcaattatggggtatgcgccaaaactggcgatcgataaaatactg
caggcaaccggcggctctatcgcggcaattgatcaaattgaattgaatgaagcatttgcc
tcacaaagcgttgctgtggctcgtgaccttggtttaaaggatgaacaattcaatatcaat
ggtggcgccttagcgttgggtcatccattgggagcttcaggtgcccgaattttaatctca
ttattgtacgatctggctgaacgtaatcaacgccaaggcattgccgcattgtgcgttggc
ggtggcatcggtatcgccatgcaaatcgcgatgcatgtctga

DBGET integrated database retrieval system