KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_01797Help
Entry
LBPG_01797        CDS       T02808                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
lpi00030  Pentose phosphate pathway
lpi00480  Glutathione metabolism
lpi01100  Metabolic pathways
lpi01110  Biosynthesis of secondary metabolites
lpi01120  Microbial metabolism in diverse environments
lpi01130  Biosynthesis of antibiotics
lpi01200  Carbon metabolism
Module
lpi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBPG_01797
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LBPG_01797
Enzymes [BR:lpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     LBPG_01797
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     LBPG_01797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD GFO_IDH_MocA 2-Hacid_dh_C 3HCDH_N AlaDh_PNT_C TrkA_N F420_oxidored NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: EEQ66348
Position
252593..253498
Genome map
AA seq 301 aa AA seqDB search
MHIGMVGLGKMGMNLVANMRDHDIEVTAFDLNDKAREAVGQYGAKAVASLDALVMSLASP
RIIWSMVPAGKPTEATISQLAKLLRPDDIVIDGGNSYYQDSIAHGKLLAAEGIHFFDVGT
SGGMAGARADGNFMIGGDKAIFNKIEPLFKAIAAKGGYLYTGPAGSGHYLKMVHNGIEYG
MMQAIGEGFDVLAHSPYDYDNAAVANMWNNGSVIRSWLMDLAANAFTEDANLEKIQGIMH
SSGEGAWTVEEALRLHVATPVIASSLMMRYRSEEADTMTGKVVAALRNQFGGHAVDPIKS
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcatattggcatggttggtttaggaaaaatgggtatgaatctggtcgcaaatatgcgc
gatcatgatattgaagtgacagcatttgatttgaacgacaaagcgcgagaagcggtaggg
caatatggggccaaggcagtggcaagcctggatgccttggttatgagcttggcatctccg
cggatcatctggagcatggtgcctgctggcaaaccgacagaagccacgattagtcagcta
gctaaactgttgcggccagatgatattgtgattgatggcggcaactcctattatcaggat
tcaatcgcacacggaaagctgctagctgctgagggaattcatttctttgatgtcggcact
tcaggcggcatggccggtgcacgcgccgatggcaatttcatgattggtggcgacaaggcg
atctttaacaagattgagccgctgttcaaggcgatcgctgcaaaaggtggctatctgtat
actggcccagctggatctggtcactatttgaaaatggttcacaacggtattgaatatggg
atgatgcaggcgattggtgaaggcttcgatgtgttagcccacagtccgtatgactacgac
aatgcggcggttgccaacatgtggaacaatggctcggtgattcgcagctggctgatggat
ttggccgccaatgcctttaccgaggatgcgaaccttgaaaagattcagggtatcatgcac
agctcgggtgaaggtgcttggaccgttgaagaagccttacgtctacatgttgcaacgccg
gtgattgccagttcgttgatgatgcgctatcgctctgaagaagcagatacgatgacgggt
aaagtggtcgctgccttgcgtaatcagtttggcggccatgcggttgatccaattaagtca
aaataa

DBGET integrated database retrieval system