KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_01831Help
Entry
LBPG_01831        CDS       T02808                                 

Definition
(GenBank) ribosomal RNA large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Brite
KEGG Orthology (KO) [BR:lpi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lpi03009]
    LBPG_01831
Enzymes [BR:lpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LBPG_01831
Ribosome biogenesis [BR:lpi03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LBPG_01831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: EEQ66382
Position
complement(1882882..1883763)
Genome map
AA seq 293 aa AA seqDB search
MRYSFTSKVTRSTTVKRWLAEQGVSHRLFKKMLADHLIWVDGQASGNGPVEAGQIIRFEI
PTSKTLTPEFAPLEVIYEDANWLIVSKPAGLTSVPGPHTPNSSLLNRIAGYLVEQKIDAP
QPAIMTRLDRDTVGLVLAAKHPYAQGRFDQAHQRTLTKHYLAVVSGKLPSPKGEIDAPLK
LAADGIHRIVAADGQTALTKYRVLKEKTNTLVDVQLLTGRTHQIRVHFASLGHPLIGDHL
YGQPDARIPYQALQATRLKFTDPFSEKRITAELPVPALFNQLLTEAPQIEPTI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcgatattcatttacgtcaaaggtgacacggtcgacaacggtcaaacgttggctagca
gagcaaggtgtcagtcatcgcttgttcaaaaaaatgctggcagatcatttgatctgggtt
gatgggcaagcatctggcaatggtccggttgaagctggccagattatccgctttgaaatt
ccgactagcaaaacgctgacgccagagtttgcgcctttagaagtcatttatgaagatgct
aattggctaattgtctcaaaaccagctggattgacaagcgttcccggaccccacacaccg
aattcgagtttattgaatcgtattgcgggctatttggttgagcaaaaaattgacgcacca
caaccagccatcatgactcgacttgatcgcgatactgtcggactggtgctggctgcaaaa
catccatacgcacaaggccggtttgatcaagcacatcaacgcacactgacgaagcattac
ttggcggttgtcagcggtaaattgccatccccaaaaggtgaaattgatgcacctctgaaa
ttagcggcggatggcattcaccgaattgtggcagctgatggccagacggcgctgacaaaa
taccgggttttaaaagaaaaaaccaatactttggttgatgtccagttgctgaccggtcgg
acacatcaaattcgcgttcattttgcaagtttaggtcatccattaattggcgatcacctt
tatggtcagccagatgcgcgaataccgtatcaagccttgcaggcgacgcggttgaaattt
acggatcctttttcggaaaagcggattacggctgaattgccggtgccggctttgtttaac
caactgctgacagaagcaccccaaattgagccaacaatctga

DBGET integrated database retrieval system