KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_01962Help
Entry
LBPG_01962        CDS       T02808                                 

Definition
(GenBank) fructose-1,6-bisphosphatase class 3
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
lpi00010  Glycolysis / Gluconeogenesis
lpi00030  Pentose phosphate pathway
lpi00051  Fructose and mannose metabolism
lpi00680  Methane metabolism
lpi01100  Metabolic pathways
lpi01110  Biosynthesis of secondary metabolites
lpi01120  Microbial metabolism in diverse environments
lpi01130  Biosynthesis of antibiotics
lpi01200  Carbon metabolism
Module
lpi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBPG_01962
   00030 Pentose phosphate pathway
    LBPG_01962
   00051 Fructose and mannose metabolism
    LBPG_01962
  09102 Energy metabolism
   00680 Methane metabolism
    LBPG_01962
Enzymes [BR:lpi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LBPG_01962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: EEQ66513
Position
complement(2024865..2026796)
Genome map
AA seq 643 aa AA seqDB search
MDLYSELTAKYQTLPAIATEIINLEAILNLPKPTEAFMSDIHGEYNAFQHVLRNGSGNVK
SKIRSCFRDEMTEATLQRFAFLVYYPSERMAAIHREMAGDDLQQWYLTTFRRLIRLLAFT
ATKYTRSKVRKAMAPEFVYITEELLYNDADTPDKLAYYWQIIRNLIVLEQADQWIAATCQ
TIQRLTVDHFHVVGDIYDRGPAPDQVVESLIRRDRRHSVDIQWGNHDILWIGGAAGSALC
IANLVRISARYNNLSILEDVYGINLRHLARLAEQYYQDNPAFSPKMERSDRPITEAERLQ
ITQIHQAIAMIQFKLEGPVIKRRPEFDMDHRLVLEKLAPDFSTIKLNGDTYTIENGCFAT
VDPADPYKLLPEEQEVIDSLVESFTHSEKLHRHMDFLLDHGSMYLRYNRNLLLHGCVPVD
EDGNFIGLTIKGTTYTGRQLFDMLEANLRLAYSQPTENADLATDLMWYLWTGPNSPLFGK
HDMTTFERYFISDPKAHVEGRNPYYHLRKDPEFIKKILAEFVLDPEVGHVINGHTPVKKG
TDPIMANNKMIVIDGGFSKPYQKTTGIGGYTLLDNSYGMQLVTHQPFTTKADAIANLTDI
ISTRRVVETEARRRTVAETDIGTELQDEVEVLKRRLGELREED
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtacagtgaactgacggcgaagtatcaaacgctgccagcgattgcgactgaa
atcattaatctggaagccattttgaatttacctaagccgacggaagcgtttatgagcgat
atccacggggagtataacgcctttcagcatgttttgcggaacggcagcgggaatgtgaaa
agcaaaattcgttcctgttttcgcgatgaaatgacggaggcgaccctgcagcgcttcgct
tttttggtgtactatccgtctgagcgaatggcggcgattcatcgggagatggcgggggat
gacttgcaacagtggtatttgacgacttttcgccggttgattcgcttgctggcgttcacc
gcgaccaaatacacgcgttcgaaagttcgcaaggcgatggcaccggagtttgtctacatc
accgaagagttgctgtacaatgatgccgatacgcctgacaagctggcttattattggcaa
attattcgtaatttaatcgttcttgaacaggccgatcagtggattgcggcaacgtgtcaa
acgattcaacgtttaacggtagatcactttcacgttgtaggcgatatctatgatcgagga
ccggcgccggatcaggtggttgaaagcttgattagacgtgatcggcgtcattcagtggat
attcaatggggcaaccatgatattctttggatcggcggcgccgcgggctcggctttgtgc
attgccaatttggtgcggatttccgcgcggtataacaatttaagtattctcgaagatgtt
tatgggattaatttgcggcatttggcccgattagcggaacaatactatcaagataatccc
gccttttcaccaaaaatggagcgatcagatcgaccaattactgaggcggagcgacttcaa
attacccagattcatcaggcgattgcgatgattcaatttaagttggaaggaccagtgatt
aaacgtcggcctgaatttgacatggatcatcggctagtgctggagaaactggcgcctgat
ttctcaaccatcaagttgaatggtgatacttatacgattgaaaacggctgttttgcgacg
gttgatccggctgatccttacaagttgttgccagaggagcaagaggtcattgactcgctg
gttgagtcctttacgcactctgaaaagttgcatcgccacatggattttttactcgatcac
ggcagtatgtatttacggtacaaccggaatttgttgctgcacgggtgtgtgccggtggac
gaggatggcaattttattggcttgaccattaaagggacgacttatactggccgtcaacta
tttgacatgctggaagcaaatcttcggttggcatacagtcaaccaacggagaatgcggac
ttagcaactgatctgatgtggtatctctggaccggtccaaattcaccgctttttggcaag
cacgacatgacgacctttgaacgctatttcattagcgatccgaaagcccatgtcgaaggt
cgtaatccgtattatcacttgcgtaaggacccggaatttatcaaaaagatcttggcggaa
tttgtcctcgatcctgaagtcggccatgtcattaatgggcatacgccagtcaaaaaaggc
accgaccccattatggcaaacaacaaaatgatcgtcatcgacggcggcttttctaaaccg
tatcaaaaaaccaccgggatcggcggctacacgcttttggataattcctatggtatgcaa
ctagtgacgcaccaaccattcaccacaaaagccgatgctatcgccaacctcaccgatatc
atttcaacccgccgcgtcgtcgaaaccgaagcccgccgccgaacagtggcggaaaccgac
atcggcactgagctacaggatgaggttgaggtattgaagcggcgcttgggtgaattgcgg
gaagaggactag

DBGET integrated database retrieval system