KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_02484Help
Entry
LBPG_02484        CDS       T02808                                 

Definition
(GenBank) transcriptional activator TenA
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
lpi00730  Thiamine metabolism
lpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LBPG_02484
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lpi03000]
    LBPG_02484
Enzymes [BR:lpi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     LBPG_02484
Transcription factors [BR:lpi03000]
 Prokaryotic Type
  Other transcription factors
   Others
    LBPG_02484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 Haem_oxygenas_2
Motif
Other DBs
NCBI-ProteinID: EEQ67035
Position
339192..339887
Genome map
AA seq 231 aa AA seqDB search
MMKFSEKARQQVVPYWEGSFTHPFITELQAGNLDPAIFRFYLIQDAYYLQHFTHLYTLIA
AQTQEPELKAYALQSAEGLAQGEITIRHVFFAELNISTTELAATTIAPTTYHYVSHMYRQ
LVEGTPHVAIAGMLPCPWLYQEVAQQLQQRKSPVPIYQRWIDTYSGADNADDQRAAIALI
DRLYDQSMPTEQQQMLAAFRISSQMEYSFWEMAYHLEAWPKGAKVDDTKQR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattttctgaaaaagctcggcagcaagttgttccgtactgggaaggcagcttc
actcacccatttattacggagctacaagctggcaaccttgatccggcgattttccgcttt
tatctgattcaggatgcttattatctgcaacattttacacatttatatacgctgattgcc
gcacagacgcaggagccggaattgaaagcttatgcgctgcagtcggctgaaggtttggcc
caaggtgaaattacgatacgccacgtttttttcgccgaattgaacatctcaacaactgag
ctggcggccaccacgattgcgccgaccacgtatcactatgtttcccatatgtaccgacaa
ttggttgaaggcacgccgcatgtggcgattgcggggatgctgccatgtccatggttgtat
caggaggtggcacagcagttgcagcaacgaaaatcacccgtgccgatttatcagcgctgg
attgacacttatagcggtgcggacaacgcggacgatcagcgagcggcgattgcgttgatt
gatcggttgtacgaccaaagcatgccgactgagcagcaacaaatgctggctgcgtttcgg
atcagcagtcaaatggaatacagcttttgggagatggcgtatcacttagaagcgtggccg
aaaggagcaaaggttgatgacacaaagcagcgttaa

DBGET integrated database retrieval system