KEGG   Limnochorda pilosa: LIP_0788Help
Entry
LIP_0788          CDS       T04150                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00620  Pyruvate metabolism
lpil00680  Methane metabolism
lpil01100  Metabolic pathways
lpil01120  Microbial metabolism in diverse environments
lpil01200  Carbon metabolism
Module
lpil_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lpil00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LIP_0788
  Energy metabolism
   00680 Methane metabolism
    LIP_0788
Enzymes [BR:lpil01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LIP_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAS26645
UniProt: A0A0K2SHU5
Position
complement(825652..828531)
Genome map
AA seq 959 aa AA seqDB search
MNDLARNLVPGPARPGEAPIQWRPQDRPLRRDVHILADMLMHILAEEVSPRLAEQVEGLR
RTCKALREGASPELEHQLEASISALPQEEALRLIRAFSLYFQLVNLAEERHRARRRRQYR
LDRPTGQAGSPEDLAVHLREAGVGPEQLQQVLNRLRITLVTTAHPTQTLRRTVIDHHQRI
AALLERLDDPRLVPAERRRVLEGLRQEIRLLWQTDELRERRPTVLDEVREGLFYFERTLL
EVAPRLLAELERALNDAYPGASLRVPGILRFGTWIGGDRDGNPRVTPEVTRRALLAQKRL
VITRYLQHLDRLGSRMSQSVRLASVPPGLTELLESYRAAFPDVYRWAAGRFPGEPFREAW
VYARWRLELARPPADPEGVADLDSFSPFRGEPPAPADPRGYPNAAAFLDDLHRIQEALGA
TSPARPHLDELDLFIRQVELFGFHLAAMDVREDGARVRRAARSLLEAAGLRPPTSPADWN
RLLAGPPLLGEPASAGSGVDPELAEILESLRVIRWAQEAIDPPAACAYLISMVHGPEALW
EALLLAREAGLFRWEPAPGEHPPAESRVDVVPLVESIGDLRRAGAILEGAWTLPAYQAQL
SARGNHQEVMLGYSDSNKDGGYFTSNWEIYQAQRRLMQAARRRGVEITFFHGRGGAIGRG
GGPSVKALMGLPPGSLPGAMRITEQGEVLSSRYLQPELAMRNLEQLATAAIWSSVPQARM
PAARTVGAHSAWEEAADRLSQLALATYRGLVERPGFEAYFRQATPIAYVERLKIGSRPSS
RPDMEEMEGLRAIPWVFAWTQSRHLIPGWYGVGTALERFATESPENLALLQEMAQAWAFW
QPLMDNLEMAMCKADLGVARLYARLAPEGKEFLDLIEDEFRRTREWVLRLSGRSELLDGQ
PVLQRSIRLRNPYVDPLSYLQVEMIRRHRAASPPEEQAVLEDAIFRSINGVVGGLRNSG
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgatctcgcacgcaacctggtgcccggccccgcgaggcccggggaagcgcccatc
cagtggcgtccccaggatcgcccccttcgccgggacgtgcacatcctggccgacatgctg
atgcacatcctggcggaggaggtctctccgcggctggctgagcaggtcgagggcctgcgg
cgcacgtgcaaggccttacgcgagggggcctcgcccgagcttgagcaccagctggaggcg
agcatctcggctctgccgcaggaggaggccctgcggctcatccgggctttctccctctac
ttccagctggtgaacctggccgaggagcgccaccgggcccggcgccggcgccagtaccgc
ctcgaccggcccacgggccaggcgggctcgcccgaggacctggccgttcacctccgggag
gccggcgtggggcccgagcagctccagcaggtcctgaaccgtctccgcatcacgttggtg
accaccgcccaccccacccagaccctgcgccgcaccgtcatcgaccaccaccagcgcatc
gccgccctcctggagcggctggacgaccctcgcctggtgcccgccgagcggcgccgggtc
ctggaggggctccggcaggagatccgcctcctctggcagaccgacgagctgcgcgagcgc
cggcccaccgtgctcgacgaggtacgcgagggcctcttctacttcgagcggaccctcttg
gaggtggcaccccggctcttggccgagctggagcgggccctgaacgacgcctacccggga
gcctccctgcgggtgcccggcatcctgcgcttcgggacctggatcggtggggaccgggac
ggcaacccccgggtcacccccgaggtcacgcgccgggcgctcctggcccagaagcggctg
gtgatcacccgctacctgcagcacctggaccgtctgggaagccgcatgagccagtccgtc
cggctggcttccgtgccccccggcctcaccgagctcctcgagagttaccgggcggccttc
cccgacgtctaccgctgggccgcggggcgcttccccggggagcccttccgggaagcctgg
gtctacgcccgctggcgcctggagctcgcccggccgcccgcggaccccgagggcgtggcg
gacctggactccttcagccccttccgcggggagccccccgccccggcggatccccggggc
taccccaacgccgccgccttcctggacgacctgcaccgcatccaggaggccctgggggcc
acctctccggcccggccccacctggacgagctggacctcttcatccggcaggtggagctc
ttcggcttccacctggccgccatggacgtacgcgaggacggcgcccgggtccgccgcgcc
gcccgctccctgctggaggcggccggccttcgcccgcccacctccccggcggattggaac
cgccttttggcgggcccacctctcttgggcgagcccgcctccgccggctccggggtggac
cccgagctggccgagatcctggagagcctgcgggtgatccgctgggcccaggaggcgatc
gacccgcccgccgcgtgcgcctacctgatcagcatggtccacggccccgaggcgctctgg
gaggcgctcctcctggcccgcgaggccggtctcttccgctgggagcccgcgcctggagag
catccgcccgcggagagccgggtggacgtggtgccgctcgtggagtccatcggcgacctg
cgccgggcgggcgcgatcctggagggcgcctggacccttcccgcctaccaggcccagctc
tccgcccgcggtaaccaccaggaggtgatgctgggctactcggacagcaacaaggacggg
ggctacttcaccagcaactgggagatctaccaggcccagcgccgtctcatgcaggccgcc
cgccggcggggcgtggagatcactttcttccacggccgcggcggtgccatcggccggggc
ggcggcccaagcgtgaaagcgctcatgggcctgccgcccgggagcttgcccggcgccatg
cggatcaccgagcagggcgaggtgctttcctcccgctacctgcagcccgagctggccatg
cggaacctggagcagctggccacggcggccatctggtccagcgtgccccaggcccggatg
cccgccgcccgcaccgtgggtgcccacagcgcctgggaggaggcggcggaccggctttcc
cagctcgccctggccacctaccgggggctcgtggagcgccccggcttcgaggcctacttc
cgccaggccacgcccatcgcgtacgtcgagcggctcaagatcggctcccgtcccagctcc
cgcccggacatggaggagatggagggtctcagggccatcccctgggtcttcgcctggacc
cagagccgccacctcatccctggctggtacggcgtcggcaccgccctggagcgcttcgcc
actgaatcgcccgagaacctggccctcctgcaggagatggcccaggcgtgggccttctgg
cagcccctgatggacaacctggagatggccatgtgcaaggcggacctgggggtggcccgc
ctctacgcgcgcctggcccccgaggggaaggagttcctggacctgatcgaggacgagttc
cgccgaacccgcgagtgggtgctgcggctctcgggccggagcgagctcctggacgggcag
cccgtcctgcagcgctccatccggctgcggaacccctacgtggaccccctgagctacctt
caggtggagatgatccggcggcaccgggcggcctcgccccccgaggagcaggctgtgctg
gaggacgccatcttccggagcatcaacggcgtggtgggaggactgcggaactcgggttga

DBGET integrated database retrieval system