KEGG   Limnochorda pilosa: LIP_0804Help
Entry
LIP_0804          CDS       T04150                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00430  Taurine and hypotaurine metabolism
lpil00460  Cyanoamino acid metabolism
lpil00480  Glutathione metabolism
lpil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LIP_0804
   00460 Cyanoamino acid metabolism
    LIP_0804
   00480 Glutathione metabolism
    LIP_0804
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lpil01002]
    LIP_0804
Enzymes [BR:lpil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     LIP_0804
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     LIP_0804
Peptidases and inhibitors [BR:lpil01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   LIP_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: BAS26661
UniProt: A0A0K2SHS9
Position
complement(846699..848300)
Genome map
AA seq 533 aa AA seqDB search
MQPFDYGSPFPSRRSPVMARHGMVATSHPLAVAAGLEVLREGGNAVDAAIATAAALTVVE
PTSNGLGSDAFALVWDGTRLHGLNASGRSPRRLTAQLVREAGFSVMPIDGWLPVTVPGAV
SGWVALSRRFGRLSFRRLFQPAIRFAEEGHPVPPLTARAWQFAERRFGAREDFRAAFLPG
GRAPRAGELFRLPEQAETLRSIGESEGEAFYRGELASRMVAHAEAQGGLLAQEDLADHEP
EWVEPLGMSRRGYRLWELPPNGQGVVALEALGLLDPLDLGSELLAGRRLHLLVEALRAAF
ADAYAHVADPTVTRVPASRLLEAGYLDERRRLLGEHRNPQIASGRPGTGDTVYLCTADAE
GRMVSFIQSNYMGFGSGVVVPGTGIALQNRGAGFTLEEGHPNQVGPGKRPFHTIIPAFLS
TEAGEPLAALGVMGGDMQPQGHLQVLLSLLDHRLDPQAALDAPRVHLLPDGRVALEPGIP
AEAREDLARRGHTLAADMGLFGFGGGQIIWRDAGQGVYIAGSDPRKDGLAMGF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccttcgactacggctcgcccttcccgtcccgccgctcgccggtgatggcccgg
cacggcatggtggccaccagccacccgctggcggtggccgcggggctcgaggtcctgcgc
gagggaggcaacgcggtggacgcggccatcgccaccgccgccgccctgacggtggtggag
cccacctccaacgggctgggctccgacgcctttgcgctcgtctgggacggcacccgcctc
cacggtctcaacgcctccgggcgcagccccaggcgcctcaccgcccagctggtgcgagag
gccggtttctccgtcatgcccatcgacggctggctcccggtgacggtgcccggggcggtt
tccggctgggtggccctctcccggcgcttcggccgcctctccttccgccgcctcttccag
ccggccatccgcttcgctgaggagggccacccggtgccgcccctcaccgctcgggcctgg
cagttcgccgagcgtcgcttcggcgcccgggaggactttcgggccgccttcctccccggc
gggcgggcgccccgggccggcgagctcttccgtctcccggagcaggccgaaacccttcgg
agcatcggggagagcgagggcgaggccttctaccggggcgagctggcctcgcgcatggtg
gcccacgccgaggcccagggaggcctcctggcccaggaggacctggcggaccacgagccc
gagtgggtggagcccctggggatgagccgccggggctaccggctgtgggaactgccgccc
aacggacagggcgtggtggccctggaggccctgggcctcctggacccactggacctgggg
tccgagctcctcgccgggcggaggctccacctcctggtggaggccctgcgggccgccttt
gccgatgcctacgcccacgtggccgaccccacggtcacgcgggtcccggccagccgcctg
ctggaagcgggctacctggacgagcgtcgacgcctgctgggtgagcaccggaacccccag
atcgcgtccggtcgccccggcaccggagacaccgtctacctctgcaccgccgacgccgag
ggcaggatggtctccttcatccagtccaactacatgggcttcggctcaggggtggtcgtg
ccgggcaccggcatcgccctccagaaccggggggcaggcttcacgctggaagagggccat
cccaaccaggtggggcccggcaagcgcccctttcacaccatcatcccggccttcctctcc
accgaggcgggggagcccctggccgccctcggcgtcatgggcggcgacatgcagcctcag
ggccacctgcaggtgctcctcagcctgctggaccaccgcctcgatccccaggccgccctg
gacgcgccccgggtccacctcctgcccgacgggcgggtggccctggagcccggcatcccc
gccgaggcccgggaggacctggcccggcggggccacaccctggccgccgacatgggcctc
ttcggcttcggcgggggccagatcatctggcgggacgccggccagggcgtttacatagcc
ggatccgatccccgaaaggacggcctggccatggggttctag

DBGET integrated database retrieval system