KEGG   Limnochorda pilosa: LIP_0819Help
Entry
LIP_0819          CDS       T04150                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00071  Fatty acid degradation
lpil00280  Valine, leucine and isoleucine degradation
lpil00310  Lysine degradation
lpil00362  Benzoate degradation
lpil00380  Tryptophan metabolism
lpil00620  Pyruvate metabolism
lpil00630  Glyoxylate and dicarboxylate metabolism
lpil00640  Propanoate metabolism
lpil00650  Butanoate metabolism
lpil00900  Terpenoid backbone biosynthesis
lpil01100  Metabolic pathways
lpil01110  Biosynthesis of secondary metabolites
lpil01120  Microbial metabolism in diverse environments
lpil01130  Biosynthesis of antibiotics
lpil01200  Carbon metabolism
lpil01212  Fatty acid metabolism
lpil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LIP_0819
   00630 Glyoxylate and dicarboxylate metabolism
    LIP_0819
   00640 Propanoate metabolism
    LIP_0819
   00650 Butanoate metabolism
    LIP_0819
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LIP_0819
   00072 Synthesis and degradation of ketone bodies
    LIP_0819
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LIP_0819
   00310 Lysine degradation
    LIP_0819
   00380 Tryptophan metabolism
    LIP_0819
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LIP_0819
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LIP_0819
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LIP_0819
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpil04147]
    LIP_0819
Enzymes [BR:lpil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LIP_0819
Exosome [BR:lpil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LIP_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAS26676
UniProt: A0A0K2SHT9
Position
complement(862648..863844)
Genome map
AA seq 398 aa AA seqDB search
MTRTAVVISTARTPFGKFGGVLQPLTAVELGAHAIRSALGRVPIEGGQVDQVLMGMVLQA
GAGQIPSRQASVAAGLPTRVPSATVNKVCASSLWAANLGETLIRAGEASVVVAGGMESMS
NAPYLLPGARWGQRMGDAEMVDSAVHDGLWCSFGGCHMGVYGGDAAREMGISRAEQDAWA
LRSHRRAVAAQDEGRFTDELVPVEVPPRRGSRSYGPLRAEVDEAPRRDTSPEQLAALKPV
FRPDDTVTAGNAPGLNDGAAALVLAGADRARELGVEPLATVVSHAGVSQEPGHLHTVPWL
SAQKALQKAGLTPSDVALWEINEAFAAVALASIRLGHLDPERVNVDGGAIALGHPIGASG
ARILIHLIHALRRRGGGYGVAAICSGGGQGEATVVRVG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaccgccgtggtgatctccacggcccgcacgcctttcggcaagttcggaggc
gtgctccagcccctgacggccgtggagctgggcgcgcacgcgatccggtccgccctggga
cgggttcccatcgagggggggcaggtggatcaggtcctcatgggcatggtcctccaggcg
ggcgccgggcagatcccttcccgccaggcaagcgtcgcggccggcctccccacccgggtc
ccctcggccacggtgaacaaggtctgcgcctcgagcctctgggccgccaacctgggggag
accctcatccgggctggcgaggcgtcggtggtggtggccggcggcatggagagcatgtcg
aacgccccctacctcctgcccggggcccgttggggccagcggatgggggacgcggagatg
gtggactctgccgtgcacgacgggctctggtgcagcttcggcgggtgccacatgggggtc
tacggcggcgatgccgcccgggagatggggatcagccgggccgagcaggatgcctgggcc
ctgcggagccaccggcgcgcggtggcggcccaggacgagggccgcttcacggacgagctg
gtaccggtggaggtccccccgcgacggggctcgcgctcgtacggccctctccgggcggag
gtcgacgaggccccccgccgcgacacctcgcccgagcagctcgcggccctgaagcccgtc
ttccgccccgacgacaccgtcaccgcagggaacgcgccggggctcaacgacggcgccgct
gccctggtgctggccggcgcggaccgggcccgggagctgggggtggagccgctggccacc
gtcgtctcccacgcaggggtctcccaggagccggggcacctccacaccgtcccctggctc
tcggcccagaaggccctccagaaggcggggctcaccccctccgacgtggccctctgggag
atcaacgaggccttcgccgccgtggccctggccagcatccgcctgggccacctggatccc
gagcgggtcaacgtggacgggggcgccattgccctgggccaccccatcggggccagcggc
gcccggatcctcatccacctgatccacgcgctgcgccggcggggcggcggctacggggtg
gccgccatctgctccggcggcggccagggcgaggcgacggtggttcgggtgggttga

DBGET integrated database retrieval system