KEGG   Limnochorda pilosa: LIP_0938Help
Entry
LIP_0938          CDS       T04150                                 

Definition
(GenBank) glycosyl hydrolase family 3
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00460  Cyanoamino acid metabolism
lpil00500  Starch and sucrose metabolism
lpil01100  Metabolic pathways
lpil01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LIP_0938
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    LIP_0938
Enzymes [BR:lpil01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     LIP_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-ProteinID: BAS26795
UniProt: A0A0K2SI84
Position
complement(990288..992549)
Genome map
AA seq 753 aa AA seqDB search
MEDLEALVRQMTLEEKASLCSGATAWTTEAIARLGIPSIVVSDGPHGLRRPAEEGQLLSR
SIPATCFPTASSLACSWDRDLVREIGQALGSESRALGVHVLLAPGVNMKRTPLCGRNFEY
FSEDPYLAGDLAAAYIEGVQSTGVGTCLKHFAANNQETDRMTVSAEIPERVLREIYLSAF
ERAVQKARPWSIMCSYNRLNGTYTSQHRQLLTDVLRDEWGFEGVVISDWGAVEDRVSGLA
AGLDLEMPGPSPANDARIVEAVRSGRLDERDLDRAVLRILDLVRRAHREAGSTEGLDVEL
HHQLARRAAAASMVLLKNQGALLPLDPARPGSVAVLGQMGVVPQFQGGGSSRVNPTKVDV
PLDELREAAPQASFSYCQGYREDGAADAELLRAAVEAARAAEVALVFVGLPDGVESEGYD
RRAMDLPAGHVELIKSVVEVQPRTAVVLQNGAPVSLADWVDRVPALLLAGLAGQASGGAV
ADLLFGEVNPSGKLAETYPARLEDNPSYLNFPGENGRVFYGEGLFIGYRYYDTKRVDPFF
PFGHGLSYTTFAYGPLSLSSREMTPAGSLEVSLPITNTGERPGEEVVQLYVRPRRSRLAR
PVKELKGFAKVDLAPGQSKPVTFTLTIRDLSYYDPDKSGWVAEPGEYDLLVGASSRDIRG
EATVRLVEGVRAEQLLDADSSIRAWLEHPAGRSTLERLLPAEVAGQFGEGPLPPFVLELP
LKKLPMLSQGAVDETTVERIVAEAGQCMGRPTP
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggaggatctggaagccctcgtacgccagatgaccctggaagagaaggcgtccctctgc
tctggtgcaaccgcctggaccaccgaagccatcgcgcgcctcggcatcccctccattgtg
gtctccgacgggcctcacgggcttcggcggcctgctgaggaaggtcagctcctgagtcgg
agcatcccggccacctgttttcccaccgcttccagcctcgcgtgctcatgggatcgggac
cttgtgcgtgagatcggccaggcactgggatcagaaagccgggccctcggggtgcacgtt
ctcctcgcccccggggtcaacatgaagcgcacgcctctgtgcggccgcaacttcgagtac
ttctcggaggatccctacctggccggcgatctggcggcagcctatatcgaaggggttcag
tccaccggcgttggcacctgtctcaagcacttcgccgccaacaaccaggagacagatcgg
atgaccgtcagcgccgagatccccgagcgagtgttgcgcgagatctacctttcggcgttc
gaacgcgccgtgcagaaagcccggccctggagcatcatgtgctcgtacaaccgcctgaat
ggtacctatacgtcgcagcaccgccagctcctcaccgatgtcctgcgggacgagtggggg
ttcgaaggcgtcgtcatctccgactggggtgctgtcgaagaccgggtgtcagggctggcc
gcgggtctggatctcgagatgcccggtccgtcccctgccaacgacgcccgcatcgtggaa
gccgtacggtcgggcaggctcgacgagcgggaccttgaccgggcggtcctccggatcctg
gacctggtgcgccgcgcccaccgggaggcgggctcgacggaaggcctggatgtcgagctt
caccaccagctggcgagacgggcggccgccgcctcgatggtgcttctcaagaaccaaggg
gccctgctccccctggacccggctcgacccggctcggtggccgtcttgggccagatgggg
gttgtgccgcagtttcagggaggcgggagttcccgcgtcaacccgacgaaggtggacgtc
ccgctggacgagctccgtgaagccgcccctcaggcgagcttctcctattgccaggggtac
cgggaggacggagccgctgatgctgagcttctgcgagccgccgtcgaagcggcgagggcc
gccgaggtcgcgttggtcttcgtagggctcccggacggcgtcgaatcggagggctacgac
cgtcgcgcgatggacctgccagccgggcacgtggagctgatcaagtcggtggtcgaggtc
caaccccgcaccgccgtcgtgctgcagaacggggcgccggtctctctggcagactgggtg
gatcgagtgcctgcgttgctgttggctggcctggcaggccaggcatcgggcggcgcggtg
gccgacctgctcttcggcgaggtcaatccctcgggcaagctggccgagacctatccggcg
cggctggaggataacccgtcctatctcaacttccccggcgagaacgggcgtgtcttctac
ggcgaggggctgttcatcggctaccgctactacgatacgaaacgcgtcgacccgttcttc
cccttcggtcacgggctctcctacacgaccttcgcgtacggaccgttgagcctcagcagt
cgtgagatgacgccggcgggctccctcgaggtctcgcttcccatcaccaacaccggcgag
cgcccgggggaggaggtcgtgcagctttacgtgaggcctcgccggtcacggctggcgcgt
ccggtgaaggagttgaaggggttcgccaaagtcgacctggctcccggccagtcgaaaccc
gtcacctttacgctcaccataagggatctctcctactacgacccagacaagagcggatgg
gtggccgaaccaggcgaatatgacctgctggtcggtgcgtcgtctcgtgacatccgaggg
gaggccacggtcaggctggtcgagggcgtgcgggccgagcaactcctggacgccgactcc
tcgatccgggcctggctggagcatccggcaggcaggtcgacgctggagcggttgctgccg
gcggaagtggccgggcagttcggcgaggggccgctaccgccattcgtgctcgagctgccg
ctgaagaagctcccgatgctgagccagggcgccgttgacgagacgacggtagagcggatc
gtcgcggaagcggggcagtgtatggggaggccgacaccatga

DBGET integrated database retrieval system