KEGG   Limnochorda pilosa: LIP_1759Help
Entry
LIP_1759          CDS       T04150                                 

Definition
(GenBank) glycogen synthase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00500  Starch and sucrose metabolism
lpil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LIP_1759
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lpil01003]
    LIP_1759
Enzymes [BR:lpil01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     LIP_1759
Glycosyltransferases [BR:lpil01003]
 Polysaccharide
  Storage polysaccharide
   LIP_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_1_2 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: BAS27605
UniProt: A0A0K2SKI3
Position
complement(1857963..1859321)
Genome map
AA seq 452 aa AA seqDB search
MRVWVVSPEPPYVASEPGRPVSGVGRHLAMLLPALAAAGVESTVLGEGRSASRGGTRWPS
PWHQPYGPLAAFHPPGRVHLSAAGSARGMGPEAGRAGGEPGAGVPGPGLGLALESPESGR
PAGEPDVIHVHDLRLVPGALEVRRLLGLPQVPVVWTAHRVPPPGRPPFRASDLAAAIAPS
RWMAHRLRTCAWAAPVPIRVVEAGPYPVAAARDRIEPPAGVTRLLSWGRLVPEKGWEELL
QAASLLSALVPGPVEWIVGGVGPLAEPLARAARRAAPNLRVMLRSPLQERELTAWLRTAA
AVVVPSREEVAGMVALEAMLAGVPLVSSAAGGLAEIVGGNGTARAWSFAAGDAAALARAV
AECLSRPDEAARRAERARGWVLHRRRWDHLARRTASVYGEAILRTAGALGTADQDRGRGQ
SWAAGNAEAAPARVGGIIRRSTAPSSACTKFS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggtctgggtggtcagtcccgagccgccgtacgtcgcatccgaaccagggcgcccc
gtcagcggcgtggggcgtcacctggccatgctgttgccggctctggcggcggccggcgtg
gagagcaccgttctgggcgaggggcgcagcgcgtcccggggcgggacccgctggccgagc
ccctggcaccagccctacgggcccctggcagcgtttcaccctccaggtcgtgtccacctt
tcggccgcgggatccgcgaggggcatggggccagaagccggcagggcgggaggcgagccg
ggagccggcgtgccagggccggggttgggactcgccctcgaaagccccgagagcggcaga
cccgcgggtgagcccgacgtgatccacgtccacgacctgcgcctggtgccgggggcgcta
gaggtgcggaggctcctgggccttccccaggtccccgtggtgtggaccgcccatcgcgtc
ccgccgccgggccggcctccgtttcgagcctcggacctcgcggctgccatcgccccgagc
cggtggatggcccatcgcctccggacgtgcgcctgggcggccccggttccgatccgcgtg
gtggaggcgggcccgtaccccgtcgcggcggcgcgcgatcgtatcgagcccccagccggg
gtcacccgcctgctgagctgggggcggctggtgcccgagaagggctgggaggaactcctg
caggctgcctctcttctgtccgccctcgtgcctgggccggtggagtggatcgtgggcggg
gtggggcctctggccgaacctctggcccgggcggcgcgccgggccgctccgaacctccgg
gtgatgctccgctcgcccctccaggagcgcgagctcaccgcctggctccgaacggccgcc
gccgtggtggtgccctcccgggaagaggtggccggcatggtggccctggaggcgatgctc
gcgggcgtgcctctggtgagcagcgcggccggaggcctggcggagatcgtgggcggcaac
ggcacagcgcgggcatggagtttcgccgccggcgacgccgccgccctggcgcgtgccgtg
gccgagtgcctctcccgtcccgacgaggcggcgcggcgggccgagcgagctcgggggtgg
gtcctccaccgccgcaggtgggaccatctggcccgcaggactgcctccgtctacggagag
gcgatcctccggaccgcgggcgcccttggcacggcggatcaggaccgggggcggggtcag
agctgggcggccggcaacgccgaggcagcccctgcgcgcgtcgggggcatcatccgccgt
tccaccgccccgtccagcgcctgcacgaagttctcgtag

DBGET integrated database retrieval system