KEGG   Limnochorda pilosa: LIP_2099Help
Entry
LIP_2099          CDS       T04150                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
lpil  Limnochorda pilosa
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LIP_2099
Enzymes [BR:lpil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     LIP_2099
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     LIP_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: BAS27940
UniProt: A0A0K2SLF7
Position
complement(2222048..2223067)
Genome map
AA seq 339 aa AA seqDB search
MRRARPRVAITLGDPAGVGPEVTLKAISRPEVLQACRPVIVGDGGVLTRAQRTLRGGEGP
AGTLELPEGVELVDLGNVPPEAHRWGERSAVAGRAGAEYVEHAVQMALAGHVAAVVTAPL
NKEALRLAEIPYPGHTEMLAALTGAAEYAMMLAGPTLRVIHVSTHVSLEEAIRRVRAPRI
LSVIRLADRVLRREGIMRPRVAVAGLNPHAGEHGLFGGQDEQEIRPAVEAAWREGIDATG
PHPPDTVFWHAQQGRFDIVVAMYHDQGHIPAKLAGFDRSVNVTVGLPIIRTSVDHGTAFD
IAGTGVASDASMVQAILYAVRLAMGTGGAKRRTAKDVDP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgcgcgtccgcgggtggctatcaccctgggggatcccgccggcgtcggcccc
gaggtcaccctcaaggcgatctcccgtccggaggtcctgcaggcctgccggcccgtcatc
gtaggggacggaggcgttctgacccgggcgcagcggacgctccggggcggcgagggccct
gcgggaacccttgagcttcccgagggggtggagctggtcgatctggggaacgtgccgccg
gaggcgcaccggtggggcgaacggagcgccgtcgccggccgagctggagccgagtacgtg
gagcacgcggtccagatggcactggcgggacacgttgccgccgtcgtcaccgcaccgctc
aacaaagaggcgctgaggctggcggagatcccctacccggggcacaccgaaatgctcgcc
gccctgacgggtgcagcggagtacgccatgatgctggccggccctaccctgcgggtgatc
cacgtctcgacccacgtcagcctcgaggaggcgatccgccgggtccgagcgccgcgcatc
ctctccgtgatccgcctcgccgaccgggtgctgaggcgggaagggatcatgagaccccgg
gtggcggtcgccggcctcaacccgcacgcgggcgagcacggcctcttcgggggccaggac
gagcaggagatccgcccagcggtggaggcggcctggcgagaggggatcgatgccaccggt
ccccacccgcccgacacggtcttctggcacgcgcagcaagggcgcttcgacatcgtcgtc
gccatgtaccacgaccaggggcacatccccgccaagctggccggtttcgatcggtccgtc
aacgtcacggtcggtcttcccatcatccggacctccgtcgaccacgggaccgccttcgac
atcgcagggacgggcgtggccagcgacgcttccatggtccaggcgatcctttacgccgtt
cgattggccatgggcaccggtggcgcgaagcgaaggacggcgaaggatgtagatccctga

DBGET integrated database retrieval system