KEGG   Limnochorda pilosa: LIP_2909
Entry
LIP_2909          CDS       T04150                                 

Definition
(GenBank) aldehyde oxidase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00230  Purine metabolism
lpil01100  Metabolic pathways
lpil01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LIP_2909
Enzymes [BR:lpil01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     LIP_2909
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: BAS28738
UniProt: A0A0K2SNN0
Position
complement(3070892..3073336)
AA seq 814 aa
MAQGYRLIGKDFQTPDAIAKVTGQARFAEDYRVDGMLFAKLFLSPMPHGRVRRIDPGPAL
AMPGVQAVLTPDEVPQVRPPGQPALASEPLFVGEPIAAVAAVDEQTAADAVARLRVDLQP
LPFVLDPLESLRPGAPNARSDGNAPARIQEQVRGTAETVTVTGVTTIKWSARDFAGAGPN
RLPMGQATEEWSYGDVEGGLAAADLVVDETFVLPNHAHHCQETRTALAYWMNGKLYLHAS
LQSLMFSVPAVAGVIGIDPSDLVLISVNTGGGFGSKAISYVQLAIPALLAKKTGRPVMLR
VSRAEEFYFGGSRPGYQARARVGFRKDGRVTAVDLFVVNDGGAYGYSDYASGFDAASLVY
QPPAMRARGISVFTNTPPKTAFRGPGTNQVPLIFEPILDRAARQLDLDRVEIRRVNAPRH
DGKIGHDRLAITSSYLPEALDKGAQLFGWGEKKSLSGRRDGPRVTGVGVGTAFHSAGASG
FDGLVLIKPDGKLSIHNGMGNLGTLSYAATARVAAEVLGVPWDQVEVHWGDTRRNLPWNA
YQAGSNSSFTMTRTNYVAAMDAKQKLQEIAAKDLGGSPADYDVADGRVFQKADPARSLTL
AQAAARAIELGGRYSGEELPADLNPLTLRSAQALAGQGLLGVAKDVLPRNGLVPAFASAF
AQVEVDTETGHVAIVDAAVVADCGTVLHPTGLWNQLRGGAIQGFGYALSESHLIDRQYGI
PLNASLYLSKPPTFLDVPPEIKVGAVDQPDPQNPVGAKGVGEPPMGAAAAAIVSAVEDAL
GVPFNRTPITPDMILRAVERKAQPFGPLEVNVVA
NT seq 2445 nt   +upstreamnt  +downstreamnt
gtggcacaagggtacaggctcatcggaaaggacttccagacaccggacgccatcgccaag
gtgacggggcaagcacggttcgcggaggactaccgggtggacgggatgctcttcgcgaag
ctcttcctgagcccgatgccccacgggcgggtccgtcggatcgacccgggcccggcgctc
gccatgcctggggtgcaggccgtcctcacgcccgacgaggtcccccaggtgcgccccccc
ggccaaccggcgctggccagcgagccgctcttcgtgggcgaacccatcgcagcggtggcg
gccgtggacgaacagacggcggccgacgccgtggcgcggcttcgggtcgacctgcagccg
ctgcccttcgtgctcgaccctctggaaagcctgaggccgggcgcgcccaacgcccgctcg
gacggcaacgctccggcgcggatccaggagcaggtgcggggcaccgccgagacggtgacg
gtcaccggcgtgacgacgatcaagtggagcgccagggacttcgcgggcgccggccccaat
cgcctgcccatgggccaggccaccgaggagtggtcctacggggacgtggagggcgggctc
gcagcggccgacctggtcgtcgacgagaccttcgtcctcccgaaccatgctcaccactgc
caggagacccgcacggcactggcctactggatgaacgggaagctctacctgcacgcctcg
ctgcagagcctcatgttcagcgttccggcggtcgccggggtcatcggcatcgacccctcg
gacctggtgctgatctccgtcaacaccggaggcggcttcgggagcaaggccatcagctac
gtccagctcgcgatccccgcgctgctggcgaagaagaccggccgccccgtgatgctgcgg
gtgagccgggccgaggagttctacttcggcggaagccgtccgggctaccaggcgcgggcg
cgggtgggtttccggaaggacgggcgcgtcacggccgtcgacctcttcgtggtcaacgac
gggggcgcgtacggctactccgactacgcctcaggcttcgacgcggcctcgctcgtctac
cagcccccggccatgcgggcccgtgggatcagcgtcttcaccaacaccccgcccaagacg
gccttccgcggccccggcaccaaccaggtccccctgatcttcgagccgatcctggaccgg
gcggcgcgccagctcgacctcgaccgggtggagatccggcgcgtcaacgcaccgcgccac
gacgggaagatcggacacgaccgcctggccatcaccagctcctacctgcccgaggcgctg
gacaaaggtgcccagctcttcggctggggtgagaagaagagcctgagcggccggcgggac
ggccctcgggtgacgggcgtcggggtcggcaccgccttccactccgccggagccagcggc
ttcgatggtctggtgctgatcaagcccgacgggaagctctccatccacaacggcatgggc
aacctggggacgctctcctacgctgcgaccgcccgggtggccgccgaggtccttggggtg
ccctgggatcaggtggaagtccactggggcgacacccggcggaaccttccctggaacgcc
taccaggccgggagcaacagctccttcaccatgacccgcacgaactacgtggccgccatg
gacgcgaagcagaagctgcaggagatcgccgcaaaggatctgggcggctctccggcggac
tacgacgtggccgacggccgggtcttccagaaagccgatcccgcccgttccctcaccctc
gcccaggccgcggcgcgggcgatcgagctcggcggcaggtacagcggcgaggagctcccc
gccgacctgaacccgctcacgctccgctcggcgcaggcgctcgccgggcaggggctgctc
ggcgtggccaaggacgtgcttccccgcaacggcctggtgccggcctttgccagcgccttc
gcccaggtggaggtggacaccgagaccgggcacgtggccatcgtcgacgccgcggtggtg
gccgattgcggcaccgtgctccacccgaccggcctctggaaccagcttcggggcggcgcc
atccagggtttcggctacgcgctgagcgagagccacctcatcgaccgccagtacggcata
ccgctcaacgcgagcctgtacctgagcaagccgcccacgttcctggacgttccgccggag
atcaaggtcggggcggtggaccagccggacccccagaacccggtgggagccaagggcgtg
ggcgagccgcccatgggggccgccgcggcggcgatcgtgagcgccgtggaggacgcgctg
ggcgtccccttcaaccggacgccgatcaccccggacatgatcctccgggccgtcgagagg
aaggcccaacccttcgggccgctcgaggtcaacgtggtcgcgtga

DBGET integrated database retrieval system