KEGG   Limnochorda pilosa: LIP_3266Help
Entry
LIP_3266          CDS       T04150                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lpil  Limnochorda pilosa
Pathway
lpil03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LIP_3266
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lpil03011]
    LIP_3266
Ribosome [BR:lpil03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LIP_3266
  Bacteria
    LIP_3266
  Archaea
    LIP_3266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAS29083
UniProt: A0A0K2SPM1
Position
complement(3435094..3435429)
Genome map
AA seq 111 aa AA seqDB search
MEARAVARYQRISPRKARLAADLIRGRSVREAEAILRFTPKKAAELFSAVLRSAVSNAEN
NLSLDRGELVVSQAYVDEGPTLKRIMPRARGMANRIRKRTSHITVVVSDKR
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtggaagcacgtgccgtggcgcggtatcagcgcatttcgccccgcaaggcgcgcctggcc
gccgacctcattcggggacgttcggtgcgggaggcggaggcgatcctgcgcttcacgccc
aagaaggcggccgagctcttctcggcggtgttgcgctccgcggtctcgaacgctgagaac
aacctgagcctggaccgcggggagctcgtggttagtcaggcctacgtcgacgagggcccc
accctgaagcggatcatgccgagggcgcggggcatggccaaccggattcggaagcggacg
agccacatcacggtggtggtctcggacaagcggtga

DBGET integrated database retrieval system