KEGG   Limnochorda pilosa: LIP_3520Help
Entry
LIP_3520          CDS       T04150                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00860  Porphyrin and chlorophyll metabolism
lpil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LIP_3520
Enzymes [BR:lpil01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     LIP_3520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA
Motif
Other DBs
NCBI-ProteinID: BAS29332
UniProt: A0A0K2SQQ6
Position
3683447..3684961
Genome map
AA seq 504 aa AA seqDB search
MTRTGGASTWARALMVQGTGSHVGKSLIAAGLCRIFAEDGHRVAPFKAQNMSLNAWVTPE
GGEISWAQAVQARAAGLPPHVDMNPVLLKPVRDTGSQVVLLGEAVGTLSAVEYQAFKPRI
WQAVLAALDRLRAAHEIVVIEGAGSPAEVNLREGDIANMAVAEAANAPVLLAADIDRGGA
LAWVVGTLELLAPEERARVRGILINKFRGDRSLLQPGLDFLEERTGVPVLGVIPYLPRIG
LPEEDTLPDERPPAPVRPDTVHVVVLRHPHLANFTDFDALAGEPDVALRFVGNGEPLGRP
DVVVLPGSKTTLADLEHLRAHGYDAAIHRLAAEGSYVVGLCGGYQMMGLEVADPLGVEGP
SRSLPGLGLLPVRTVLRPTKLTALARGESLLPGMEGPVEGYEIHMGESERAGGSSALRLQ
RRNAPRGEVDDGCWAGDGRVFGTYLHGLFDHPGFRRSFLNRVRAGKGLPTLPPAPEAPPD
EPYRRLAQALRESVDIEAVYRLMG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggacaggtggggcaagcacctgggcccgcgcgctcatggtccaggggaccggc
tcccacgtaggcaagagcctcatcgccgccgggctctgccgcatcttcgccgaggacggc
caccgggtcgcccccttcaaggcgcagaacatgtcgctcaacgcctgggtgacgcccgag
gggggcgagatcagttgggctcaggcggtgcaggctcgcgccgcgggcctcccgccccac
gtcgacatgaacccggtcctcctcaagcccgtccgggacacgggctcccaggtggtcctc
ctgggcgaggcggtggggaccctctccgccgtcgagtaccaggcgttcaagccccggatc
tggcaggcggtcctggcggccctggaccgcctccgggccgcccacgagatcgtcgtcatc
gagggggccggaagcccggccgaggtgaacctgcgggagggcgacatcgccaacatggcc
gtggccgaagctgcgaacgcccccgtcctcctggcggcggacatcgaccggggcggggcg
ctggcctgggtggtggggaccctggagctgctcgcgcccgaagagcgggcccgggtgcgg
gggatcctcatcaacaagttccggggggatcgctcgctcctccagccgggcctcgacttc
ctggaggaacggacgggcgtacccgtgctcggggtgatcccctacctcccccggatcggc
ctccccgaagaggacaccctccccgatgagcgcccgcccgcccccgtgcggccggacacc
gtccacgtcgtggtgctccggcacccccacttggccaacttcaccgacttcgacgccctg
gccggggagccggacgtggccctccgcttcgtggggaacggggagccgctgggccgcccc
gatgtggtcgtcctgcccggctccaagaccaccctggccgacctggagcacctgagggcg
cacggctacgacgccgccatccaccgcctcgcggcggaggggtcgtacgtggtcggcctc
tgcggtggttaccagatgatggggctggaggtggccgatcccctgggcgtcgagggaccc
tcgcggtccctcccgggcctagggctcctgccggtgcgaacggttctccgccccaccaag
ctgacggccctggcgcggggcgagtcgctcctccccgggatggaaggccccgtggagggg
tacgagatccacatgggcgagagcgagcgggcaggaggctcctccgccctccgcctgcag
cgccggaacgctccgcgcggcgaggtcgacgacggctgctgggccggcgacggccgcgtc
ttcggtacctacctccacggtctcttcgaccaccccggattccgccggagcttcctcaac
cgggtacgggccgggaaggggctgccgacgctcccaccggccccggaggcgccgcccgac
gagccctaccggcggctggcgcaggccctgcgggagagcgtcgacatcgaggccgtctac
cgcctgatgggctga

DBGET integrated database retrieval system