KEGG   Limnochorda pilosa: LIP_3633Help
Entry
LIP_3633          CDS       T04150                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00670  One carbon pool by folate
lpil01100  Metabolic pathways
lpil01120  Microbial metabolism in diverse environments
lpil01200  Carbon metabolism
Module
lpil_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LIP_3633
Enzymes [BR:lpil01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     LIP_3633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: BAS29441
UniProt: A0A0K2SQQ9
Position
3795227..3796900
Genome map
AA seq 557 aa AA seqDB search
MPTDIEIAQSVSLRPIGEIAAHLGLEDDEWEPYGRTKAKVTLEALQRRLTQPRIGRLIYV
TAITATAAGEGKTCTAIGLTQGLGKVGRQATVCLREPSLGPTFGIKGGAAGGGYAQVVPM
EEINLHFTGDIHAVGTAHNLLAAVIDNHLSKGNALRIDPNRVVWRRVMDMNDRELRQVVV
GLGGPANGVVRETGFDITVASEVMAILCLADSITDLKERLGRMLVAYTYEGEPVYARDLG
VHGAMAALLRDAFRPNLVQTLEGQPAFVHGGPFANIAHGNNSILATELALRLSELVVTEG
GFGADLGAEKFFDIVHGYTGLTPDVVVLVASVRALHMHGGVSKREVEQANPEALLAGMPN
LIRHIENVQRFGLPVVVAINRFPTDAPEELELIRTRCAEMGVPVALSDVVARGGEGGVEL
AAAVLDALDQRPADFRPLYHWNLPITEKLDRLATQIYGADGVELSPAAQKQVREAERNGW
GQLPLCVAKTQHSLSDDPDLKGAPTGWKLRVREIRPSLGAGFLVCLAGDVMTMPGLPTHP
AAERVDIDASGRITGLF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaccgacattgagatcgcgcagagcgtaagcctgcgccccatcggcgagatcgcc
gcccacctgggcctggaggacgacgagtgggagccgtacggacgcacgaaggccaaggtt
accctggaggcgctccagcggaggctcacgcagccccgcatcgggcgcctgatctacgtc
accgccatcacggccaccgccgccggcgagggcaagacgtgcaccgccatcggcctcacc
cagggcctcggcaaggtgggccggcaggcgaccgtctgcctgcgcgagccgtcgctgggc
cccaccttcggcatcaagggtggggcggccggtgggggctacgcccaggtggtgcccatg
gaggagatcaacctccacttcacgggagacatccacgccgtgggcaccgcgcacaacctg
ctggccgcggtgatcgacaaccacctgagcaaggggaacgcccttcgcatcgatcccaac
cgggtcgtctggcggcgggtcatggacatgaacgacagggagctgcggcaggtcgtggtc
ggcctgggcggcccggcgaacggggtggtccgggagacgggcttcgacatcaccgtcgcc
tcggaggtgatggcgatcctctgcctggccgatagcatcacggatctcaaggaacgactg
ggccggatgctggtcgcctatacctacgagggcgagcccgtctacgcccgcgacctgggc
gtgcacggggccatggcggccctgctgcgggacgccttccggcccaacctggtgcagacg
ctcgagggccagccggccttcgtccacggagggcccttcgccaacatcgcgcacggcaac
aactcgatcctggccaccgagctggcgctgcggctctcggagctggtcgtcaccgagggc
gggttcggcgcggacctgggagcggagaagttcttcgacatcgtgcacggctacaccggc
ctcacccccgacgtggtggtgctcgtggcctcggtgcgggccctccacatgcacggcggg
gtgtcgaagcgcgaggtggagcaagccaaccctgaggcgctcctggcgggtatgcccaac
ctgatccggcacatcgagaacgtccagcgcttcggtctgccggtggtggtggccatcaac
cgcttccccaccgacgcgccggaggagctggagctgatccgtacccggtgcgcggagatg
ggcgtccccgtcgccctttcagacgtggtggcccggggcggcgaggggggcgtggagctg
gccgcagcggtcctggatgccctcgaccagcgccccgccgatttccgtccactctaccac
tggaacctccccatcaccgagaagctcgaccggctggcgacccagatctacggagccgac
ggggtggagctcagccccgcggcccagaagcaggtccgggaggcggagaggaacgggtgg
ggccaactccccctttgtgtggccaagacccagcactcgctctcggacgatcccgacctg
aagggcgccccgaccgggtggaagctccgggtgcgggagatccgcccctcgctgggcgcg
gggttcctggtctgcctggccggagacgtcatgaccatgccggggctgccgacccacccc
gccgcggagcgggtggacatcgacgcctcggggcgcatcaccggcctgttctag

DBGET integrated database retrieval system