KEGG   Lactobacillus plantarum JDM1: JDM1_2659
Entry
JDM1_2659         CDS       T00946                                 

Symbol
pflB2
Name
(GenBank) formate C-acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00620  Pyruvate metabolism
lpj00640  Propanoate metabolism
lpj00650  Butanoate metabolism
lpj01100  Metabolic pathways
lpj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JDM1_2659 (pflB2)
   00640 Propanoate metabolism
    JDM1_2659 (pflB2)
   00650 Butanoate metabolism
    JDM1_2659 (pflB2)
Enzymes [BR:lpj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     JDM1_2659 (pflB2)
SSDB
Motif
Pfam: PFL-like Gly_radical SatD
Other DBs
NCBI-ProteinID: ACT63545
Position
2864815..2867073
AA seq 752 aa
MITSEKTTKPAAWKGFKGGHWQEEINIRDFIQNNFTQYNGDESFLAGPTAATKTLNDKVL
ELKKQERAAGGVLDADTKVVATITSHGPGYIQKDLEKIVGLQTDKPLKRAFMPFGGIRMA
DDALKSYGYTPDEENDKIFTEYRKTHNQGVFDVYTPDMRKARHYKIITGLPDAYARGRLI
PDLPRVAVYGIDRLMEDKANDFAHIGDGELTDDVIRLREEVQDQYRALADMKKMAASYGY
DISKPATNAQEAIQWMYFAYLAAIKTQNGAAMSVGRIDTTMDIFIQRDLDNGVLDESQAQ
ELIDQFVMKLRMVRFIRTEEYNSLFSGDPIWATLSMCGLGVDGQHHVTKTAFRILKTLDN
MGAAPEPNITILWSDRLPEDFKRYATEVSIDSSTIQYENDDLMRVQWGTDYYGIACCVSA
QPIADGIQYFGARANLAKAILYAINGGRDEIAGDQVGPAYEPITSEYIDYDEFMKKLDKQ
MDWLADTYVNSLNAIHYMHDKYYYEAAQLALKNTDLDRTFATGISGLSHAADSISAIKYG
HVKVIRDERGIAVDFKADNDYPRYGNNDDRADDIAKWLVKELYSKMNTHHLYRNAKLSTS
VLTITSNVVYGKNTGTTPNGRQKGEPFSPGANPAYGAEKSGALASLLSTAKLPYRYATDG
ISNTFGVTPNTLGHDLESRKDTLVNMLDGYMKNDGMHLNINVFNKDTLIDAQKHPEEYPT
LTVRVSGYCVYFADLTKEQQDDVISRTFFESM
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgattacatcagaaaagacaacaaaaccagcagcttggaaaggtttcaaaggcgggcac
tggcaggaagaaatcaacattcgtgattttattcaaaataacttcacacagtacaatggc
gacgaaagcttcctggccggaccaacagccgctactaagaccttgaatgacaaagtctta
gaattaaagaaacaagaacgtgccgctggtggtgtgttggacgctgatactaaagtcgtt
gcaacgattacttcacacggccctggttatattcaaaaagatctcgaaaagattgttggt
ctccagactgacaagcctttgaagcgggccttcatgccatttggtggtattcgaatggct
gatgacgctttgaaatcatacggttatacccctgatgaagaaaacgacaagattttcact
gaatatcgcaagactcataaccaaggcgtcttcgatgtttatactcctgacatgcggaaa
gcacgtcactacaagatcatcaccggactaccagatgcatacgcacgtggccgtctcatt
cctgatcttccacgggtcgctgtttatgggatcgatcgtttaatggaagacaaagctaat
gactttgcccacattggtgatggtgaattgactgatgatgttattcgcctccgtgaagaa
gttcaagatcaataccgtgctttagcagatatgaagaagatggctgccagttatggctac
gatattagcaagcctgcaactaatgctcaagaagctattcaatggatgtacttcgcttac
ttagctgctatcaagacccaaaacggcgctgcaatgtccgttggccggattgatacaacg
atggacatcttcatccaacgtgacttggacaatggtgttctggacgaaagccaagctcaa
gaattaattgatcaattcgtcatgaaactacggatggttcggttcatccgtactgaagaa
tacaattctctcttctctggtgacccaatctgggcaaccttatcaatgtgtggtttaggc
gtcgacggtcaacaccatgtgactaagaccgctttccggattttaaagactttggacaac
atgggcgccgcaccagaaccaaacatcacgattttatggtcagatcgcttaccagaagac
ttcaaacgttacgcaactgaagtttcaatcgacagttcaaccattcagtatgaaaatgat
gacttgatgcgggtacaatggggtaccgattattatggcattgcttgctgtgtttccgca
caaccaattgctgatggaatccagtacttcggtgcccgggcaaacttagccaaagcgatt
ctttatgccatcaatggtggccgcgacgaaattgctggagatcaagttggccctgcttac
gaaccaattacttcagaatacatcgattacgacgaattcatgaagaaattagacaagcaa
atggattggttagctgacacttacgtgaactcactgaatgcaattcattatatgcatgat
aagtactactatgaagctgcccaattagctttgaagaatactgatcttgatcggaccttt
gcaactgggatttctggcttatcacatgccgcggattcaatctcagctatcaagtatggt
cacgttaaagtaattcgtgacgaacgtggtatcgccgttgacttcaaagccgacaatgac
tacccacgttatgggaacaatgacgatcgcgctgatgacattgctaaatggttagtcaaa
gaattatacagcaagatgaacacgcatcacctctatcggaatgccaaactttcaacttct
gttttgacgattacctccaacgttgtttatggtaagaacactggtaccacaccaaatggc
cgtcaaaaaggcgaaccattctcaccaggtgctaaccctgcatacggtgctgaaaagagt
ggtgcattagcttcacttctttcaactgccaaattaccataccgttacgcaactgacggg
atttccaacacgttcggcgttacccctaacacgttaggccatgacctcgaatcacggaaa
gacacgttagtaaacatgttagacggttacatgaagaacgatgggatgcacttgaacatc
aacgtcttcaataaagacactttgattgatgctcagaaacaccctgaagaatacccaaca
ttaacggttcgggtttctggctactgtgtctacttcgcagatttaaccaaggaacaacaa
gatgacgttatttcacggacattcttcgaatcaatgtaa

DBGET integrated database retrieval system