KEGG   Lactobacillus plantarum JDM1: JDM1_0722Help
Entry
JDM1_0722         CDS       T00946                                 

Gene name
gmk2
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00230  Purine metabolism
lpj01100  Metabolic pathways
Module
lpj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    JDM1_0722 (gmk2)
Enzymes [BR:lpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     JDM1_0722 (gmk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 dNK AAA_23 T2SSE MMR_HSR1 AAA_33 AAA_17 AAA_16 SKI AAA_28 AAA_30 ABC_tran Thymidylate_kin AAA_14 AAA_29 CoaE NTPase_1 PRK RNA_helicase cobW AAA_13 DUF2075 AAA_19 AAA_5 ATPase_2 AAA Rad17
Motif
Other DBs
NCBI-ProteinID: ACT61609
Position
776022..776603
Genome map
AA seq 193 aa AA seqDB search
MTTKRIFVITGPTGSGKTTVSHYLRSQYQIPQVITHTTRAPREGEVSGRDYYFETPASFV
TKHYLEHVTYSGNQYGSSREGLAAAWERSPLISIVLDTAGAITYARELGEQAVVIYLEVA
DQEALIQRLTKRGDLPSRIKKRVASDEYLRDQALPVGLVGHAHVIVNDDWQATRRQLDEL
VTEYCQHDVVTKD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgacaacgaaacggatctttgtgatcacgggaccaacggggagtggtaagaccactgtc
agtcattacttgcggtcacaataccaaattcctcaggtgattactcatacgacccgggct
ccccgggaaggtgaagtcagtgggcgcgactattattttgaaactccggcgagttttgtc
acgaaacattatttagaacacgtgacctatagtggtaatcaatacggttcttcacgagaa
ggactagcggcagcctgggaacggtcaccactgattagtatcgtcttagatacggcgggg
gctattacctatgcgcgggagttgggcgaacaagcggtggtgatttatctcgaggttgct
gatcaagaggcgctaattcagcgtttgaccaagcgaggagatcttcctagccggataaaa
aagcgagttgctagtgatgagtatttgcgggaccaggctttgccagtaggattagtgggg
catgcacatgttatcgtgaatgatgattggcaggcgacgcggcgccaactagatgagctg
gtcactgaatattgtcagcatgatgttgtgacgaaagattag

DBGET integrated database retrieval system