KEGG   Lactobacillus plantarum JDM1: JDM1_0855Help
Entry
JDM1_0855         CDS       T00946                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lpj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    JDM1_0855 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lpj03011]
    JDM1_0855 (rplV)
Ribosome [BR:lpj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    JDM1_0855 (rplV)
  Bacteria
    JDM1_0855 (rplV)
  Archaea
    JDM1_0855 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACT61742
Position
920048..920395
Genome map
AA seq 115 aa AA seqDB search
MAEQVTSARATAKTVRIAARKVRLVVDLIRGKSVAEALAILKFTPRGASPVVEKVLLSAV
ANAENNFDLDREDLVVSEAFVNEGPTLKRFRPRAKGSASPINKRTSHITITVTEK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagtaacatctgcacgtgcaactgcaaaaactgttcgtattgccgctcgt
aaggtccgcctagttgtcgatcttatcagaggtaaaagtgttgccgaagccttagcaatc
ttgaagttcactccacggggtgcttctccagtagtagaaaaagttttactttctgctgtt
gctaacgctgaaaataactttgacttagatcgcgaagatttggtcgtaagcgaagctttt
gttaacgaaggaccaaccttaaaacggttccgtccacgggcaaagggttctgcttcacca
atcaacaagcggactagccacattacgatcacagttactgaaaaatag

DBGET integrated database retrieval system