KEGG   Lactobacillus plantarum JDM1: JDM1_1318Help
Entry
JDM1_1318         CDS       T00946                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00010  Glycolysis / Gluconeogenesis
lpj00052  Galactose metabolism
lpj00500  Starch and sucrose metabolism
lpj00520  Amino sugar and nucleotide sugar metabolism
lpj00521  Streptomycin biosynthesis
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01120  Microbial metabolism in diverse environments
lpj01130  Biosynthesis of antibiotics
lpj01200  Carbon metabolism
Module
lpj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lpj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_1318 (glk)
   00052 Galactose metabolism
    JDM1_1318 (glk)
   00500 Starch and sucrose metabolism
    JDM1_1318 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    JDM1_1318 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    JDM1_1318 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    JDM1_1318 (glk)
Enzymes [BR:lpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     JDM1_1318 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACT62205
Position
1416908..1417870
Genome map
AA seq 320 aa AA seqDB search
MERKLIGVDLGGTTTKFAILTENGDIQQKWSIETTILDEGAHIVPNIIDSINHHIELYKM
DRSQFIGIGMGTPGTVDLDNGTVIGAYNLNWKTLQPVKAQIEKGTGIKFTLDNDANVAAL
GERWKGAGENGSDVVFVTLGTGVGGGIIADGRLLHGIAGGAGEIGHVTVEPNGYMCTCGK
KGCLEQYASATGVVHVARDMAEEFSGASKLKQLLDNGEEISSKITFDLAKEGDVLAKRVV
DRVSYYLGLALANVGNTMNPSSIIIGGGVSAAGDFLLDQVISYFNQFTFPTIRDTTALKL
AVLGNDAGVIGAGSLAQRFI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtaagttaatcggagtcgaccttggtgggacgacaactaagtttgccatttta
acagaaaatggtgatattcaacaaaagtggagtattgaaaccacgattttagatgaaggg
gcccacattgtgcctaacatcatcgattccatcaaccaccacattgagttatataagatg
gaccgttctcaatttatcggaattggaatggggactcccgggaccgttgatttggataat
ggtacggttatcggtgcctacaacttaaactggaagaccttacaaccagttaaggctcaa
attgaaaagggaactggcatcaaatttacgctggataacgacgctaacgttgctgcactt
ggcgaacgttggaagggcgctggcgaaaacggtagtgacgttgtctttgtaacgcttgga
actggtgttggtggtgggatcatcgccgatggccgtttactccatggtattgccggtggt
gccggtgaaattggtcacgtaacggttgaaccaaacggctacatgtgtacttgtggtaag
aaaggttgtttggaacaatacgcttctgcaactggtgtcgttcacgttgctcgcgatatg
gcagaagaattctctggtgcttctaagttgaaacaattattagacaacggtgaagaaatt
agttcaaagatcactttcgatttagctaaagaaggcgatgtcttggctaaacgcgttgtt
gatcgggtttcttattacttaggcttggcattagctaatgtcgggaacacgatgaaccca
tcttcaatcattatcggtggtggggtttcagctgctggtgatttcttattagatcaagtc
atcagttactttaaccaattcacattcccaacgattcgcgacacgactgctttgaagtta
gcggtcttaggtaacgacgctggtgttatcggagcaggttcattggcccaacggtttatt
taa

DBGET integrated database retrieval system