KEGG   Lactobacillus plantarum JDM1: JDM1_2059Help
Entry
JDM1_2059         CDS       T00946                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00340  Histidine metabolism
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01230  Biosynthesis of amino acids
Module
lpj_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    JDM1_2059 (hisD)
Enzymes [BR:lpj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     JDM1_2059 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACT62946
Position
complement(2190705..2191991)
Genome map
AA seq 428 aa AA seqDB search
MKIINEDLASLKRLVQTKTQQLTDLKVESAVREIIANVIKNGDAAVKDYETQFDKVTLTD
FKLSQTVIDDAYNNLDPQVKDALLLAKRNITSFHEKEKATGFIDAEQPGVLRGQKLMPLN
RVGLYVPGGTAAYPSTLLMSALPAKIAGVNEVIMVTPPQVDGINPAVLAATKIAGVDAIY
QVGGAQAIAALAYGTESIPAVDKIIGPGNIFVATAKKQVFGQVAIDMVAGPSEIGILADD
SADPRQLAADLLSQAEHDRRARPILITDSADLAQAVSDNVTSQLKVLPREAIATDAVNEK
GFIAVVAKVEEMFDLMNTVAPEHLEVQLKNPTQYLNLIKNAGSVFLGRYASEPLGDYVAG
PNHILPTSGTARFSSPLGVYDFVKRTSFIQYTKDALAKEAPAITTLARVEGLEGHARAIE
SRFDTYYD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattaatgaagatttagctagtttaaaacgcttagttcaaacgaagacccaa
caattgactgacttaaaggttgaatcagcggttcgcgaaattattgccaatgtgattaaa
aacggggatgccgccgtcaaggattacgaaacccaattcgataaggtcaccttgaccgac
tttaagttgtcacaaactgttattgatgatgcttataacaatctggacccgcaagtgaag
gacgccttgttgttagctaaacgcaatatcacgagttttcacgaaaaggaaaaggcgact
ggctttattgatgctgaacagcctggcgttctacgagggcagaagttaatgccgcttaat
cgggttggcttatacgttccaggtggcacggcagcctatccatcgactttactgatgagt
gccttgcccgctaagattgccggcgttaatgaagtcattatggtgacgccaccacaagtc
gatggcatcaatccagccgttcttgctgcaaccaaaatcgctggcgtcgacgccatctat
caagtgggaggcgctcaagcaattgctgcgttagcttatgggactgagtcgattccagcg
gtcgacaagattattggtcctgggaacatttttgtggcgactgctaagaagcaggtcttt
ggtcaggtggcgatcgacatggtggccggcccgtcagaaattggtattttagcggatgat
tcagctgatcctcggcaattagcggctgacttattgagtcaagcagaacatgaccgtcga
gcccggccaatcctaattacggatagtgccgacttagcgcaggccgtcagtgacaacgtg
acgtcacagttgaaagttttgccacgagaagcgatcgctaccgacgctgttaacgaaaaa
ggcttcattgccgttgtcgcaaaggttgaagaaatgtttgacttgatgaatacggtggca
ccagaacacttggaagtgcaattgaagaatccaactcagtacttgaatttaatcaaaaat
gccgggtcggtcttcttaggacgctacgcctctgaaccactcggtgactacgttgctggt
ccgaaccacatcttaccaacgagtggcacggcccgtttctcatcaccacttggcgtctat
gatttcgttaagcgaacgtcctttatccaatacactaaggacgctttggctaaggaagct
ccggcgattaccacgttggcacgggtcgaaggtctggaaggccatgctcgtgcgattgag
agtcgttttgacacctattacgattaa

DBGET integrated database retrieval system