KEGG   Lactobacillus plantarum JDM1: JDM1_2535Help
Entry
JDM1_2535         CDS       T00946                                 

Gene name
pmg9
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00010  Glycolysis / Gluconeogenesis
lpj00260  Glycine, serine and threonine metabolism
lpj00680  Methane metabolism
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01120  Microbial metabolism in diverse environments
lpj01130  Biosynthesis of antibiotics
lpj01200  Carbon metabolism
lpj01230  Biosynthesis of amino acids
Module
lpj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lpj_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_2535 (pmg9)
  Energy metabolism
   00680 Methane metabolism
    JDM1_2535 (pmg9)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JDM1_2535 (pmg9)
Enzymes [BR:lpj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     JDM1_2535 (pmg9)
Membrane trafficking [BR:lpj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    JDM1_2535 (pmg9)
Exosome [BR:lpj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   JDM1_2535 (pmg9)
  Exosomal proteins of melanoma cells
   JDM1_2535 (pmg9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF2283
Motif
Other DBs
NCBI-ProteinID: ACT63421
Position
complement(2729462..2730154)
Genome map
AA seq 230 aa AA seqDB search
MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEEAKAAGQKVKEAGLEFDYAFTSVLTR
AIKTLHYVLEESDQLWIPETKTWRLNERHYGALQGLNKKETAEKYGDDQVHIWRRSYDVL
PPLLSADDEGSAVNDRRYADLDPNIVPGGENLKVTLERVMPFWEDQIAPKLLDGKNVIIA
AHGNSLRALSKYIEQISDDDIMDLEMATGEPVVYDFDEKLKVLGKEKLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagtattgattcgtcacggtcaaagtgaatggaacttatctaaccaattt
actggttgggttgacgttgatttaagcgaaaagggtgttgaagaagctaaggctgctggt
caaaaagttaaagaagcaggcttagaattcgattacgcctttacttcagttttgactcgt
gccatcaagactttgcactatgtgcttgaagaatccgaccaactctggattccagaaacc
aagacttggcgtttaaacgaacgtcattatggtgcattacaaggattgaacaagaaggaa
accgctgaaaaatacggtgacgaccaagttcatatctggcgtcgttcttatgatgtttta
cctccattattgagtgccgatgatgaaggttcagccgttaacgatcgtcgttacgctgac
ttagaccctaacatcgtccctggtggcgaaaacttgaaggttaccttggaacgcgttatg
cctttctgggaagaccaaatcgcacctaagttattagacggcaagaatgtaatcattgct
gcccacggtaactcattacgtgccttaagcaagtacatcgaacaaatcagtgatgatgat
atcatggaccttgaaatggctactggcgaaccagttgtctatgactttgatgaaaagtta
aaggttcttggtaaggaaaagttaggcaaataa

DBGET integrated database retrieval system