KEGG   Lactococcus piscium: LACPI_0520Help
Entry
LACPI_0520        CDS       T03909                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpk  Lactococcus piscium
Pathway
lpk00071  Fatty acid degradation
lpk00280  Valine, leucine and isoleucine degradation
lpk00362  Benzoate degradation
lpk00380  Tryptophan metabolism
lpk00620  Pyruvate metabolism
lpk00630  Glyoxylate and dicarboxylate metabolism
lpk00640  Propanoate metabolism
lpk00650  Butanoate metabolism
lpk00900  Terpenoid backbone biosynthesis
lpk01100  Metabolic pathways
lpk01110  Biosynthesis of secondary metabolites
lpk01120  Microbial metabolism in diverse environments
lpk01130  Biosynthesis of antibiotics
lpk01200  Carbon metabolism
lpk01212  Fatty acid metabolism
lpk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LACPI_0520
   00630 Glyoxylate and dicarboxylate metabolism
    LACPI_0520
   00640 Propanoate metabolism
    LACPI_0520
   00650 Butanoate metabolism
    LACPI_0520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LACPI_0520
   00072 Synthesis and degradation of ketone bodies
    LACPI_0520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LACPI_0520
   00310 Lysine degradation
    LACPI_0520
   00380 Tryptophan metabolism
    LACPI_0520
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LACPI_0520
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LACPI_0520
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LACPI_0520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpk04147]
    LACPI_0520
Enzymes [BR:lpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LACPI_0520
Exosome [BR:lpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LACPI_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CEN27720
UniProt: A0A0D6DW60
Position
I:533204..534343
Genome map
AA seq 379 aa AA seqDB search
MERVFIVDSARTAIGKFGGIFSDILPEYLGGDLLKKLLARQQLSRVDEVIVGNIIGGGGN
VGRRLALASGLAVETPALTIDRQCASGLESLVVATAKIKSGMASSIACGGVESTSRSPWL
IERPAKLFGGPPKIIERAALSIDAYGDPAMGEACEALASRLQISRLQQDAYAYQSQVKYQ
QANQSGTFKDEIIGVKHATADESPRADTNLKKLAALPAVFKENGTLTAGNSSPLNDGAAF
VIIASESFCKTNQLQPLFEVVDGVSVGTLPENFGLGPVYATEKLLAKQGLTISEIDRIEL
NEAFASQALACIQTAGWQEARVNRSGGALAFGHPFGATGAILVRRLMTELEKRPTLKTGL
VTMCVGGGQGTSLLLRKVD
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtgtattcattgttgatagtgcaagaacagctataggtaaatttggtgggatt
ttctcagacatcctgccggagtatctaggtggtgatttactaaaaaaactacttgctagg
caacaacttagtcgagttgatgaagtgattgtcggcaatatcataggtgggggcggaaat
gttggtcggcgtcttgctttagcgtcaggactagcagtcgaaacgcctgctctgaccata
gatcgacagtgtgcatctggactggaaagtctagtcgttgcaactgcaaaaataaaaagt
ggcatggcctcatctattgcctgtggtggtgtagagagcacaagtcgctctccatggttg
attgagagacctgctaagctttttggaggcccaccgaaaataatcgagagagctgcccta
agtattgatgcttatggcgatcctgctatgggggaggcttgcgaagcattagcttctagg
ttacaaatcagtcggctacaacaagatgcctatgcctatcagagtcaagtcaagtatcaa
caggcaaaccaatctggcacctttaaagacgagatcattggcgtaaaacatgctactgca
gatgaaagtcctcgggcggacacaaatcttaaaaaattagcagccttaccagcagttttt
aaggaaaatgggacattaacagctggcaatagttcgccattaaatgatggtgctgccttc
gtcattattgcgagtgagtcattttgcaagacaaatcaactccagcctttatttgaagtc
gttgatggtgtttcagtaggcactttaccagaaaattttggattaggtccagtctatgcg
acagagaagttattagccaaacagggattaactatctctgaaattgatcggattgagcta
aatgaagcgtttgcgtcacaggccttagcctgcattcaaaccgctggttggcaagaggcg
cgtgttaatcgatcaggaggcgccttagcctttggtcatccttttggtgcgacaggtgcc
atattagtgcgccgtttgatgacagagttagaaaagcggcctaccttaaagacgggtctc
gtcacgatgtgtgtcggtggtgggcaggggacgtctctactgctaagaaaggttgactga

DBGET integrated database retrieval system