KEGG   Lactococcus piscium: LACPI_0824Help
Entry
LACPI_0824        CDS       T03909                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lpk  Lactococcus piscium
Pathway
lpk00010  Glycolysis / Gluconeogenesis
lpk00020  Citrate cycle (TCA cycle)
lpk00620  Pyruvate metabolism
lpk01100  Metabolic pathways
lpk01110  Biosynthesis of secondary metabolites
lpk01120  Microbial metabolism in diverse environments
lpk01130  Biosynthesis of antibiotics
lpk01200  Carbon metabolism
Module
lpk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACPI_0824 (pdhC)
   00020 Citrate cycle (TCA cycle)
    LACPI_0824 (pdhC)
   00620 Pyruvate metabolism
    LACPI_0824 (pdhC)
Enzymes [BR:lpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LACPI_0824 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: CEN28024
UniProt: A0A0D6DW55
Position
I:856207..857505
Genome map
AA seq 432 aa AA seqDB search
MTEIFKMPDVGEGMAEGEIASWLVKVGDAIKEDDPIAEIQNDKLLQEILSPYTGVVTKLY
VEAGTVVEVGAPLVEFDGDGSGASEAAPVAPEAAVPTAAPTPVAAEAAPTAPASGKVGAP
VIGGQVRAMPSVRRLARQNGIDLTTVPANGRHGNITLEDVRNVLSGATVAPEAPVSAEVS
ETPEAVATPAAAPKAVVSEKAGRVPMTPIRKAIAKNMTSQKQNVPHVTLFEQVEVSKLMA
HRAAFKDIALKQDVKLTYMAYVAKALAAMAKHFPDLNAHVDMAKTEIVYPEGIHIGIAVD
TPNGLFVPVVKNADQKSILAIAKEIAELAERARDGKLTPDVASGSTITISNIGSARGNWF
TPVINVNEAAILGLGTIAKEPIVNEEGEIVVGNMMKLSLSFDHRLVDGMLAQSAINDLKK
MLNDPAYMLMEV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaatctttaaaatgcccgatgtcggcgagggaatggcagaaggcgaaatcgct
tcttggttagttaaggttggcgatgcgattaaagaagacgatccaattgcagaaattcaa
aatgataaattattgcaagagatcttatcaccatatactggtgtcgtaactaaattatat
gttgaggctggtacagtagtagaagttggggcacctttagttgaatttgatggtgacggt
tctggcgcttcagaagcagcaccagttgcacctgaagcagcagtgcctacggcggcacca
acaccagttgcagcagaggcagcaccaacggcaccagcatctggtaaagttggcgctcca
gttatcggtggacaagttcgtgctatgcctagtgtacgtcgtttggcacgtcaaaatggt
attgatttaacaactgttccagcaaatggtcgtcatggtaatatcacgcttgaggatgtt
agaaacgtcttgtcaggcgctactgtagcacctgaagcaccagtatctgctgaagtatct
gaaacacctgaagcagtcgctacacctgcggcagcacctaaagctgttgtttctgaaaaa
gccggtcgtgtaccgatgacgccaattcgtaaagcaatcgctaaaaatatgactagccaa
aaacaaaatgtgccacatgtgacattatttgaacaggttgaagtttctaaattgatggcg
cacagagcagcattcaaagatatcgccctaaaacaagatgttaaattgacttatatggct
tatgttgctaaagcattggctgcgatggcaaaacatttccctgacttaaatgcccatgtt
gatatggctaaaacagaaattgtttacccagaaggcatccacattggtatcgcagttgat
acaccaaatggcttgtttgtacctgttgttaaaaatgcagatcaaaaatcaatcttggct
attgctaaagaaattgctgaattggcagagcgtgcacgtgatggtaaattaacaccagac
gttgcaagtggctcaacaatcacgatttcaaacattggtagtgcacgtggtaactggttt
acaccagttatcaatgttaacgaagccgctattctaggcttagggacaatcgctaaagag
cctatcgttaatgaagaaggtgagatcgttgttggtaatatgatgaaactttccttgtca
tttgaccaccgtcttgtagatggtatgctcgcacaaagtgcaatcaatgacttgaagaaa
atgttgaatgatccagcatatatgctgatggaggtataa

DBGET integrated database retrieval system