KEGG   Lactobacillus plantarum WCFS1: lp_3313
Entry
lp_3313           CDS       T00115                                 

Symbol
pflB
Name
(GenBank) formate C-acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00620  Pyruvate metabolism
lpl00640  Propanoate metabolism
lpl00650  Butanoate metabolism
lpl01100  Metabolic pathways
lpl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lp_3313 (pflB)
   00640 Propanoate metabolism
    lp_3313 (pflB)
   00650 Butanoate metabolism
    lp_3313 (pflB)
Enzymes [BR:lpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     lp_3313 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical SatD
Other DBs
NCBI-ProteinID: CCC80313
UniProt: F9UTJ5
Position
2949058..2951316
AA seq 752 aa
MITSEKTTKPAAWKGFKGGHWQEEINIRDFIQNNFTQYNGDESFLAGPTAATKTLNDKVL
ELKKQERAAGGVLDADTKVVATITSHGPGYIQKDLEKIVGLQTDKPLKRAFMPFGGIRMA
DDALKSYGYTPDEENDKIFTEYRKTHNQGVFDVYTPDMRKARHYKIITGLPDAYARGRLI
PDLPRVAVYGIDRLMEDKANDFAHIGDGELTDDVIRLREEVQDQYRALADMKKMAASYGY
DISKPATNAQEAIQWMYFAYLAAIKTQNGAAMSVGRIDTTMDIFIQRDLDNGVLDESQAQ
ELIDQFVMKLRMVRFIRTEEYNSLFSGDPIWATLSMCGLGVDGQHHVTKTAFRILKTLDN
MGAAPEPNITILWSDRLPEDFKRYATEVSIDSSTIQYENDDLMRVQWGTDYYGIACCVSA
QPIADGIQYFGARANLAKAILYAINGGRDEIAGDQVGPAYEPITSEYIDYDEFMKKLDKQ
MDWLADTYVNSLNAIHYMHDKYYYEAAQLALKNTDLDRTFATGISGLSHAADSISAIKYG
HVKVIRDERGIAVDFKADNDYPRYGNNDDRADDIAKWLVKELYSKMNTHHLYRNAKLSTS
VLTITSNVVYGKNTGTTPNGRQKGEPFSPGANPAYGAEKSGALASLLSTAKLPYRYATDG
ISNTFGVTPNTLGHDLESRKDTLVNMLDGYMKNDGMHLNINVFNKDTLIDAQKHPEEYPT
LTVRVSGYCVYFADLTKEQQDDVISRTFFESM
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgattacatcagaaaagacaacaaaaccagcagcttggaaaggtttcaaaggcgggcac
tggcaggaagaaatcaacattcgtgattttattcaaaataacttcacacagtacaatggc
gacgaaagcttcctggccggaccaacagccgctactaagaccttgaatgacaaagtctta
gaattaaagaaacaagaacgtgccgctggtggtgtgttggatgctgatactaaagtcgtt
gcaacgattacttcacacggccctggttatattcaaaaagatctcgaaaagattgttggt
ctccagactgacaagcctttgaagcgggccttcatgccatttggtggtattcgaatggct
gatgacgctttgaaatcatacggttatacccctgatgaagaaaacgacaagattttcact
gaatatcgcaagactcataaccaaggcgtcttcgatgtttatactcctgacatgcggaaa
gcacgtcactacaagatcatcaccggactaccagatgcatacgcacgtggccgtctcatt
cctgatcttccacgggtcgctgtttatgggatcgatcgtttaatggaagacaaagctaat
gactttgcccacattggtgatggtgaattgactgatgatgttattcgcctccgtgaagaa
gttcaagatcaataccgtgctttagcagatatgaagaagatggctgccagttatggctac
gatattagcaagcctgcaactaatgctcaagaagctattcaatggatgtacttcgcttac
ttagctgctatcaagacccaaaacggcgctgcaatgtccgttggccggattgatacaacg
atggacatcttcatccaacgtgacttggacaatggtgttctggacgaaagccaagctcaa
gaattaattgatcaattcgtcatgaaactacggatggttcggttcatccgtactgaagaa
tacaattctctcttctctggtgacccaatctgggcaaccttatcaatgtgtggtttaggc
gtcgacggtcaacaccatgtgactaagactgctttccggattttaaagactttggacaac
atgggcgccgcaccagaaccaaacatcacgattttatggtcagaccgcttaccagaagac
ttcaaacgttacgcaactgaagtttcaatcgacagttcaaccattcagtatgaaaatgat
gacttgatgcgggtacaatggggtaccgattattatggcattgcttgctgtgtttccgca
caaccaattgctgatggaatccagtacttcggtgcccgggcaaacttagccaaagcgatt
ctttatgccatcaatggtggccgcgacgaaattgctggagatcaagttggccctgcttac
gaaccaattacttcagaatacatcgattacgacgaattcatgaagaaattagacaagcaa
atggattggttagctgacacttacgttaactcactgaatgcaattcattatatgcatgat
aagtactactatgaagctgcccaattagctttgaagaatactgatcttgatcggaccttt
gcaactgggatttctggcttatcacatgccgcggattcaatctcagctatcaagtatggt
cacgttaaagtaattcgtgacgaacgtggtatcgccgttgacttcaaagccgacaatgac
tacccacgttatgggaacaatgacgatcgcgctgatgacattgctaaatggttagtcaaa
gaattatacagcaagatgaacacgcatcacctctatcggaatgccaaactttcaacttct
gttttgacgattacctccaacgttgtttatggtaagaacactggtaccacgccaaatggc
cgtcaaaaaggcgaaccattctcaccaggtgctaaccctgcatacggtgctgaaaagagt
ggtgcattagcttcacttctttcaactgccaaattaccataccgttacgcaactgacggg
atttccaacacgttcggcgttacccctaacacgttaggccatgacctcgaatcacggaaa
gacacgttagtaaacatgttagacggttacatgaagaacgatgggatgcacttgaacatc
aacgtcttcaataaagacactttgattgatgctcagaaacaccctgaagaatacccaaca
ttaacggttcgggtttctggctattgtgtctacttcgcagatttaaccaaggaacaacaa
gatgacgttatttcacggacattcttcgaatcaatgtaa

DBGET integrated database retrieval system