KEGG   Lactobacillus plantarum WCFS1: lp_0220
Entry
lp_0220           CDS       T00115                                 

Gene name
gpo
Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00480  Glutathione metabolism
lpl00590  Arachidonic acid metabolism
lpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    lp_0220 (gpo)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    lp_0220 (gpo)
Enzymes [BR:lpl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     lp_0220 (gpo)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 1061406
NCBI-ProteinID: YP_004888270
UniProt: F9UT25
Position
202845..203330
AA seq 161 aa
MAESVYDFTETEMSGAPLDLSQYRGQVLLIVNTASNCGLAPQFKGLEELYQKYQQEGLVV
LGLPSNQFHQEKADDDETHDYCQRHYGVTFPMTKRVMVNGDDADPLFTYLKQAAGHGRIK
WNFTKFLIGRDGRVLERYAPTTRPATFEAAIRDALADRSED
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcagaatcagtgtatgattttacagaaactgagatgagtggtgcgccacttgacttg
tcacaatatcgcggtcaggtcttgctaatcgtgaatacggctagcaactgtggcctggcg
ccacagtttaaaggattagaagaactttatcagaagtatcagcaggagggcctagtggtc
ttgggattgccatccaatcaatttcatcaagaaaaggcggatgacgatgagacccatgac
tattgtcaacggcactacggggtaacgtttcccatgaccaaacgggtgatggttaatggt
gatgacgctgatccgttatttacttacctcaaacaggcggcgggacatggtcgaatcaag
tggaatttcacaaaattcctgattggtcgtgatggccgtgtgctcgaacgctatgcccca
acgacacggccggcaacatttgaagcagcgattcgtgatgccttggctgatcgttcagaa
gattaa

DBGET integrated database retrieval system