KEGG   Lactobacillus plantarum WCFS1: lp_0415
Entry
lp_0415           CDS       T00115                                 
Symbol
plnA
Name
(GenBank) plantaricin A precursor peptide, induction factor
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB
Motif
Pfam: DUF6576 Bacteriocin_IIc Antimicrobial17
Other DBs
NCBI-ProteinID: CCC77922
UniProt: P80214
Structure
Position
371368..371514
AA seq 48 aa
MKIQIKGMKQLSNKEMQKIVGGKSSAYSLQMGATAIKQVKKLFKKWGW
NT seq 147 nt   +upstreamnt  +downstreamnt
atgaaaattcaaattaaaggtatgaagcaacttagtaataaggaaatgcaaaaaatagta
ggtggaaagagtagtgcgtattctttgcagatgggggcaactgcaattaaacaggtaaag
aaactgtttaaaaaatggggatggtaa

DBGET integrated database retrieval system