KEGG   Lactobacillus plantarum WCFS1: lp_0454Help
Entry
lp_0454           CDS       T00115                                 

Gene name
metS
Definition
(RefSeq) methionine-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00450  Selenocompound metabolism
lpl00970  Aminoacyl-tRNA biosynthesis
lpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    lp_0454 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    lp_0454 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lpl01007]
    lp_0454 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lpl03016]
    lp_0454 (metS)
Enzymes [BR:lpl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     lp_0454 (metS)
Amino acid related enzymes [BR:lpl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   lp_0454 (metS)
Transfer RNA biogenesis [BR:lpl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    lp_0454 (metS)
 Prokaryotic type
   Other AARSs
    lp_0454 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 tRNA-synt_1c
Motif
Other DBs
NCBI-GeneID: 1064149
NCBI-ProteinID: YP_004888471
UniProt: Q88Z97
Position
406690..408741
Genome map
AA seq 683 aa AA seqDB search
MAETKPTYYITTPIYYPSGKLHIGNSYTTIACDTLARYKRAMGYDVYFLTGTDEHGLKIE
EKAEKLNTDPKSYVDGMAKQIKDLWQLLEISNDKFIRTTDDYHERAVQEIFDRLLKNGDI
YLGEYEGWYSVDDEEYFTETQLAEVFRDDNGKVIGGKAPSGHEVELVKEQSYFFKMSKYA
DWLLDYYQSHPDFIEPANRMTEMINNFIKPGLEDLAVSRTSFTWGVPVKSDPKHVVYVWI
DALTNYITALGYATGDSEDLFNKFWPADVQMVGKEIVRFHTIYWPIILHALGLPLPKKVF
GHGWLLMKDGKMSKSKGNVIYPETLVERYGLDALRYYLVKAMPYGNDGLFTPEDFVARVN
YDLANDLGNLLNRTIAMINKYEDGQLPAFKAGVTEFDADLEATAATTIKNFNACMDSLHL
SDALAEVWKLVSRTNKYIDETAPWQLAKSDDANDADKLASVMAHLAASLRVIASLISPVM
THAPKEIFTQLGLDPATLAIADLQLADLPAGAQVVAKGTPIFPRVDMDAEVEFLKGKMTK
SDKQKGRKAMENAKHEAEVEQGWNPAETNLNLTKPAITIDDFDKVELKVAEVITVQKLKG
ADKLLQFRLDAGDADHRQILSGIAKWYPEPEELIGKKVIIVGNLKPRKLRGEMSQGMLLS
AEHDGQVQLITVPDNMVNGSLIS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacaaaaccaacttattatattacgacgccgatctactatccttcggggaag
ttgcacatcggtaattcatacacgacaattgcgtgtgatactttagcacgttacaaacgt
gcgatgggttacgatgtttacttcttaaccgggacggatgaacacggcctcaaaattgaa
gaaaaagcagaaaaattgaacactgatccgaagtcatacgttgatgggatggcaaaacaa
atcaaggatttatggcaattgctagaaatctctaatgacaagtttattcggaccaccgat
gattatcatgaacgcgcggtccaagaaattttcgatcggttacttaaaaatggtgacatc
tacttaggtgagtacgaaggctggtactccgttgatgacgaagaatacttcactgaaacg
cagctggctgaagttttccgtgatgataacggcaaggttattggtggtaaggcgcccagt
ggtcatgaagtcgaacttgttaaagaacagtcctacttctttaagatgagtaagtacgca
gattggttgttagattattatcaaagtcatcctgactttattgaaccagccaatcggatg
accgaaatgatcaataattttattaaaccaggtctggaagacttggccgtttctcggacg
agctttacttggggtgtccctgtcaagagtgatcctaagcacgtcgtttacgtgtggatt
gatgccctgacaaactatattacggcactgggttacgcaaccggcgactctgaagacttg
tttaacaagttctggcctgccgatgttcaaatggttggtaaagaaatcgtgcgcttccat
acgatttactggccaattattttgcatgcactcgggttaccattacctaagaaggttttt
ggtcatggttggttattgatgaaggacggcaagatgtccaagtctaagggtaacgtgatt
tatcctgaaacattggttgaacgttacggcttggatgcgcttcgttattatttagttaaa
gccatgccttatggtaacgatggtttattcacaccagaggactttgtggcgcgggttaac
tatgacttggctaatgacttgggaaacttgctgaaccggaccattgcgatgatcaataaa
tatgaagatggtcaattaccagcattcaaagccggtgtgactgaatttgacgctgactta
gaagccacagctgccacgactattaagaacttcaacgcttgcatggacagcctgcattta
tcggatgcgctggctgaagtgtggaagttggtcagtcggacgaacaagtatattgatgaa
acggcaccttggcaattagctaagagtgacgatgcgaatgatgctgataagttagccagt
gtgatggcccatttagcagctagtttgcgggtgattgctagtttgatcagtccggtcatg
acgcatgcacctaaggaaatctttacccaattagggttggacccagcaactttagcaatt
gccgacttacaactggctgatttgccggctggcgcacaagtcgttgctaagggaacccca
atcttcccacgggtcgatatggatgccgaagttgaattcttgaagggtaagatgacgaaa
tccgacaaacagaaggggcgtaaagccatggaaaacgcgaaacatgaagctgaagtcgaa
caaggctggaacccagctgagactaatttgaacctcactaaaccagcaattaccattgat
gattttgacaaggtcgaattgaaagttgctgaagtcattacggtgcagaaattgaaaggg
gctgacaaactcctacaattccgtttagatgcaggagatgctgatcatcgccaaatcctt
tcaggtattgctaagtggtatccagaaccggaagaactgattggcaagaaggttatcatc
gttggtaacttaaagccacggaagcttcgtggtgaaatgagccaaggcatgttactgtca
gcagaacacgacggtcaggtgcaattaattacggtaccagataatatggtaaacggatca
ttgatttcgtaa

DBGET integrated database retrieval system