KEGG   Lactobacillus plantarum WCFS1: lp_0514Help
Entry
lp_0514           CDS       T00115                                 

Gene name
srtA
Definition
(RefSeq) sortase A
  KO
K07284  sortase A [EC:3.4.22.70]
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.70  sortase A
     lp_0514 (srtA)
Peptidases [BR:lpl01002]
 Cysteine Peptidases
  Family C60
   lp_0514 (srtA)
Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
 Peptidoglycan biosynthesis and degradation
  Sortase
   lp_0514 (srtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sortase Flp1_like DUF3687
Motif
Other DBs
NCBI-GeneID: 1061503
NCBI-ProteinID: YP_004888520
UniProt: F9UKZ1
Position
460295..460999
Genome map
AA seq 234 aa AA seqDB search
MKSKQHPGLKWLGRGVFVLLVLVSLALIFNEQIKSWLVSSYSPTVTAKTVKQNTKKKSDF
NFSKVKSLDFQTVAKARMNKNAINVIGSIAIPSVDLYLPIGNGVSNETLALAAGTMKANQ
KMGQGNYALAGHHMIKHGALFSPLYYKSKVGQMIYVSDAKKIYAYKTSQRTFIKATDVQV
IDDVPGQKLITLITCDKTGAGRLMIRGKYEQQWSFKSAPTQVQKAFTSHFNNKY
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccaagcaacatcccgggttaaagtggttaggtcggggcgtttttgtcctgctg
gtgctagtatcattggcattaattttcaatgaacagatcaagagctggttagtgagttca
tactcgccgaccgttacggctaagacggttaagcagaatacgaagaagaagagcgatttt
aacttctcaaaggtcaagtcacttgactttcagaccgttgccaaggcccgcatgaataag
aatgcaatcaacgtgattggctcgattgcgattccgtccgttgatttgtacctgccaatc
ggtaatggtgtcagcaatgaaacgttagcattggcggctggcacgatgaaagctaatcag
aagatggggcagggtaactacgcgttggctggtcaccatatgatcaagcatggtgcacta
ttcagtccgttgtactataagagcaaggttggccaaatgatttatgtgagtgatgccaaa
aagatttatgcgtataagacgagtcagcgaacattcattaaagcaactgatgtccaagta
attgatgatgttcctggtcagaagctgattaccctaattacctgtgataagaccggggcg
ggtcgcttaatgattcgcggtaagtacgaacagcaatggtcgtttaagtcggcgccaact
caggttcagaaggcctttacaagtcattttaataacaaatattaa

DBGET integrated database retrieval system