KEGG   Lactobacillus plantarum WCFS1: lp_0520Help
Entry
lp_0520           CDS       T00115                                 

Gene name
rhe1
Definition
(RefSeq) ATP-dependent RNA helicase
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    lp_0520 (rhe1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:lpl03019]
    lp_0520 (rhe1)
   03009 Ribosome biogenesis [BR:lpl03009]
    lp_0520 (rhe1)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     lp_0520 (rhe1)
Messenger RNA biogenesis [BR:lpl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     lp_0520 (rhe1)
Ribosome biogenesis [BR:lpl03009]
 Prokaryotic Type
  rRNA helicases
   lp_0520 (rhe1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII AAA_22 Helicase_RecD CMS1 AAA_30
Motif
Other DBs
NCBI-GeneID: 1061824
NCBI-ProteinID: YP_004888525
UniProt: F9UKZ6
Position
465293..466879
Genome map
AA seq 528 aa AA seqDB search
MKFTELGLSDSLLKAVNRAGYEEATPIQAETIPMVLEGKDVIGQAQTGTGKTAAFALPIL
QRLDFDNHNIQALVVSPTRELAIQTQEEIFRLGKDERAKVQVVYGGADIRRQIRNLKQNP
QVIVGTPGRLLDHIRRGTVKLDHVKMLVLDEADEMLNMGFLEDIESIIKQVPDERQTMLF
SATMPPEIKRIGVQFMKEPHHVKIKSKEMTADTVDQYYVKAKEFEKFDIMTRLFDVQAPE
LTIVFGRTKRRVDELSKGLEARGYNAAGIHGDLSQQRRTQIMRQFKAGKLDILVATDVAA
RGLDVSGVTHVYNYDIPQDPDSYVHRIGRTGRAGHKGVSLTFVTPNEMEYLRVIEKLTKK
RMLPLKPPTESEAFAGQLAAAEANVDSLVAKTSTEKYADQAAELLQKYDATDLVAALLND
LTKDDASAVPVKITPERPLPRHKGGGGNNRRGGYRGGNRNRNNSHGNGRGGYSHNGRNRD
RDRNGGRGDRKSNGYKGRSRDDNRSSNRNHDEGRKQSSKRSYTIRTND
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtttacagaactaggcttatccgatagcctacttaaagcagttaatcgggccgga
tacgaagaagcgaccccgattcaagccgaaaccattccaatggttctagaaggcaaagat
gtgattggtcaagcacaaaccggtactgggaagaccgccgcgtttgcattaccaatctta
caacgcttggattttgacaaccataacattcaagcattagttgtttcaccaacgcgtgaa
ttagcaatccaaactcaggaagaaatcttccgcttaggtaaagacgaacgggcgaaagtc
caagtcgtttacggtggtgctgatattcggcgccaaatcagaaatctgaagcaaaaccca
caagtaatcgtcggaactcccggccggttgcttgaccacattcgccggggcacggtcaag
ttagaccacgtcaagatgttagttcttgatgaagctgacgaaatgttaaacatgggtttc
ttggaagatatcgaatcaattatcaaacaagtgccggatgaacgccaaactatgttgttc
tccgcaacgatgccacctgaaatcaaacgcattggtgtgcagttcatgaaggaaccgcat
cacgttaagatcaaatcaaaagaaatgactgctgatacggtcgatcaatattacgttaaa
gccaaagaatttgaaaagttcgatattatgacccggttgtttgatgttcaggcacctgaa
ctcacaatcgtgtttggtcgaacgaaacgtcgagttgacgaattatcaaagggtctcgaa
gcacgtggttataatgccgctgggattcatggtgatttgagccaacaacgtcggacgcaa
atcatgcgtcaattcaaggctggtaaattggatattctggttgcaaccgatgtggctgct
cggggacttgatgtttctggtgtgacccacgtttacaattatgatattccacaggatccg
gacagttatgttcaccggattggccgtactggccgtgccggacacaagggtgtttcatta
acttttgtaacaccaaacgaaatggaatatttgcgggtcattgaaaagttgaccaagaag
cggatgttaccattgaagccaccaactgaatctgaagcttttgctggccaactagctgct
gcagaagccaatgttgattcattagttgccaagacttcaactgaaaagtatgctgatcag
gctgctgaattattacaaaaatacgatgctactgatctagttgctgccttgttaaatgac
ttaactaaggacgacgcctcagccgtacccgttaagattacgccagaacgcccattacct
cgtcacaaaggtggcggcggtaacaaccggcgtggcggatatcgtggcggtaatcgcaac
cgcaataacagtcatggcaatggtcgtggcggttattctcacaatggtcgcaatcgcgac
cgtgatcgtaacggtggccgtggcgatcggaagagcaatggttataaaggtcgcagtcgc
gatgataaccggagcagcaaccgcaaccatgatgaaggtcgcaagcaaagcagcaagcgg
agctatacgatccgcaccaatgattaa

DBGET integrated database retrieval system