KEGG   Lactobacillus plantarum WCFS1: lp_0522Help
Entry
lp_0522           CDS       T00115                                 

Gene name
acpS
Definition
(RefSeq) holo-(acyl-carrier-protein) synthase
  KO
K00997  holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    lp_0522 (acpS)
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     lp_0522 (acpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACPS
Motif
Other DBs
NCBI-GeneID: 1061816
NCBI-ProteinID: YP_004888526
UniProt: Q88Z44
Position
467904..468266
Genome map
AA seq 120 aa AA seqDB search
MIYGTGIDLTELSRIEAILAKGLRLPEKILTPAELAVFSRYPVKRQIEFMAGRFSAKEAY
SKAYGTGIGAAVGFQDIEILDNAQGKPEVTRHPFDGPAWISISHTDTLVMTQVILERGNL
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
gtgatttatggtaccggcattgatttaactgagcttagtcggattgaagcgattctagcg
aagggactgagattgcctgaaaagatcttaacaccggctgagttggcggtgttttcacgt
tacccggttaaacgccagatcgagtttatggcagggcgtttttcagctaaggaagcatat
agtaaggcatatggcacgggaattggtgcggcagttggatttcaagatatcgaaatttta
gacaacgcccagggtaaaccggaagttacgcgccacccgtttgatggtccagcgtggatt
tcaatttcacacacggatacgttagtaatgacacaagttatattggaaagaggcaatttg
tga

DBGET integrated database retrieval system