KEGG   Lactobacillus plantarum WCFS1: lp_0523Help
Entry
lp_0523           CDS       T00115                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00473  D-Alanine metabolism
lpl01100  Metabolic pathways
lpl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    lp_0523 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    lp_0523 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
    lp_0523 (alr)
Enzymes [BR:lpl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     lp_0523 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
 Precursor biosynthesis
  Racemase
   lp_0523 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Shigella_OspC
Motif
Other DBs
NCBI-GeneID: 1061815
NCBI-ProteinID: YP_004888527
UniProt: O08445
Position
468266..469393
Genome map
AA seq 375 aa AA seqDB search
MVVIGEHRHTQVTVDLQAIKTNISNEMAQKDELTELWAVVKANGYGHGIIQVAQAAKEAG
ATGFCVAILDEALALRAAGFAEPILVLGITEPEYAPLVAEKDISLAVGTQDWLTTAAAIL
AANQVTTPLHVHLALDTGMGRIGFQTPEELATAVTTLRQPQSPFDFEGIFTHFATADQAD
DTYFTHQLNNWKHLIAVVDELPRYVHVSNSATSLWHQACNGNMVRFGVALYGLNPSGREL
SAPYPLQPALSLTARLTFVKRLARGKSVSYGATYTAAQDEWIGTVPIGYADGYERRLQGF
HVLVDGEFCEIVGRVCMDQLMVRLPHEVPVGAKVTLVGTDGARTISLQDIADYCGTIHYE
IACGLAPRVPRVYID
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaattggggagcaccgccacacacaagtcacagtcgacttgcaggcaattaag
acaaatattagtaatgaaatggcgcaaaaggatgagttgaccgagttatgggcagtcgtt
aaagcgaatggttatggacatggaattatccaagttgctcaggccgccaaagaagccggg
gcgaccggcttttgtgttgcaatcctggatgaggccttagcgttgcgggccgctggcttt
gcggaacccatcctagtacttggaattacggaaccggaatacgccccactggtagctgaa
aaggatatttcactagctgttggaacgcaagattggctgactacggccgcagcaatttta
gcggctaatcaagtgacgacaccacttcacgttcatcttgcattagatacgggtatggga
cgaatcgggtttcagacgcccgaagaattggcaacggcggttacgactttgcgtcaaccg
cagtcaccatttgactttgaagggatttttacgcattttgcaacggctgaccaggcagat
gatacgtattttactcatcaattaaataattggaaacacttgattgcagtggtggatgag
ctaccacgctatgtccacgtgtccaattcggccaccagtctctggcatcaagcttgcaat
ggcaacatggtgcgctttggggttgcactctatggtctaaatccttctggtcgcgaactc
agcgcaccataccccttgcaacccgcgttgtcgctaacggcacgcttgacgtttgttaaa
cgcttggctcggggcaaatcggtcagctatggtgccacgtatacggccgcacaggatgaa
tggattggcacggtgccgattgggtatgcggacggctatgaacgccgattacaaggcttc
catgtacttgttgatggtgagttttgcgaaatcgtcggacgggtctgcatggaccagctg
atggttcgtctgccacatgaagtaccggttggagctaaggtaactttggttggcacggac
ggtgctcgtaccatttcgttgcaagatattgctgactattgtgggacaattcattatgag
attgcttgtgggttagcaccacgagtgccgagagtttatatagattaa

DBGET integrated database retrieval system