KEGG   Lactobacillus plantarum WCFS1: lp_0525Help
Entry
lp_0525           CDS       T00115                                 

Gene name
kup1
Definition
(RefSeq) potassium uptake protein
  KO
K03549  KUP system potassium uptake protein
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
Transporters [BR:lpl02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   lp_0525 (kup1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: K_trans
Motif
Other DBs
NCBI-GeneID: 1061850
NCBI-ProteinID: YP_004888529
UniProt: Q88Z42
Position
470486..472468
Genome map
AA seq 660 aa AA seqDB search
MSKQAQFNKHRVAGLLVAMGVVYGDIGTSPLYVMKAIITGQGGMQAVDEKFMLGAVSLVF
WTMTLLTTVKYVLIALNADNHGEGGIFSLFALVRHRARWLVIPAMIGGAALLADGALTPA
VTVTTAIEGLRDVPAYVQLFGASQNTIILITLGIITLLFMLQRFGTNTIGKLFGPIMLGW
FTFLGVSGFVNLVQDWTILRALNPYYAWLLLISPANKVGILILGSVFLATTGAEALYSDL
GHVGKTNIRLSWPYVKVCLLLSYFGQAAWILGPGQAIQGHVNPFFAMLPASLTMAAVIFA
TLAAIIASQSLISGSFTLVSEAIRLKLFPRLLTTYPGKAVGQMYLPVVNWGLWGVTSMLV
IFFQTSERMEAAYGLAITLTMLMTTTLIYAFLRQKRLPLIGAGLLTGFFATIEVIFLIAS
AAKFWHGGYVAVGLALLIFLVMAVWYRGEQIVRQHNHPLSLRQYQDQLAKLRDDQTVDKF
QTNVVFLTSRMDGDQVERKVLYSILDKWPKRADVYWFVNVTITDEPYTAEYTVDTLATDY
LVTVKLYLGFRVRQDINRYLRTIVRDLMATGRLAAQKQTYSVTSGRDVGDFRFVIIEEKL
ENGSRLSRLDRLVIETKLMIKKYATTPAKWFGLEFSEVTLETVPILFNEIPALPITERQR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacaggctcagttcaataagcatcgggtggcaggattgttagtcgcgatgggt
gttgtatatggtgatattggaaccagtccgttatacgtgatgaaggccatcattaccggt
caaggtgggatgcaggccgttgatgagaagtttatgttgggggccgtctcgctagttttt
tggacaatgacgctgctcacgaccgttaagtacgttttgatcgcgttaaacgcggataat
catggcgaaggcggtatcttttcactattcgcattggtgcgtcatcgtgcgcgctggtta
gtcattcctgccatgattggtggggctgcgttactggcggatggggcgctaacccccgca
gtgacagttacgactgccatcgaaggcttacgcgatgtaccagcatacgttcaactgttt
ggtgccagccaaaatacgattatactgattacgcttggaattatcaccctattatttatg
ctgcaacgttttggaacgaacacgattggcaagttatttggccccatcatgttgggctgg
ttcacgtttttgggagtcagtggcttcgttaatctggtgcaggattggacgatcctgcgt
gcactgaatccctattatgcgtggttactcttgatcagcccggcgaacaaagtgggaatc
ttgattctagggagcgtctttctggcaacgaccggtgctgaggccctatacagtgacctt
gggcacgtcggcaaaacgaatattcggttgagctggccgtatgtcaaagtttgtctacta
ctcagctatttcggtcaggccgcatggattttaggtcccggccaagcgattcagggacat
gtgaatcccttttttgcaatgttacctgctagcctgacgatggcggcagtgatttttgcg
acgctcgcggccattatcgcgtcacagtcgctgatcagtgggtcgtttacgttagttagt
gaagcgattcgactgaaactattcccccgattactgactacttaccccggtaaagcagtg
ggccaaatgtatttaccggtcgttaactgggggctgtggggcgtgacgagtatgctggtg
attttctttcaaactagtgaaagaatggaagctgcatacgggttagccatcacactgaca
atgctgatgacgaccactttgatctacgcgtttttacggcaaaagcgcttaccattaatc
ggtgcgggactactgaccggtttcttcgcgaccatcgaagtgattttcctgattgccagc
gcagccaagttctggcacggcggctacgtagcggtcggacttgctttactaattttccta
gtgatggccgtgtggtatcgtggcgaacaaattgtccgacaacataaccacccgcttagt
ttacgacaatatcaggaccagcttgctaagttacgcgacgatcagacggtggacaagttc
cagacgaacgtcgtcttcctaacaagccgaatggatggcgaccaagtggagcgaaaggta
ttatattcgattttagacaagtggccgaaacgtgccgacgtctactggtttgttaatgtg
acaatcacggatgaaccgtataccgcggagtatactgtcgacacgttagcaacggactat
ttggtaactgttaagttatacctgggctttcgtgtccgccaagatattaaccgctattta
cggacgattgtccgcgacttaatggctactggacgtttagcggcgcaaaagcagacatat
tcagtcacttctggccgcgatgtcggtgacttccgcttcgttatcatcgaggagaagtta
gaaaatggtagtcggttatcccgcttggatcgattagtgatcgagacgaaattaatgatt
aaaaaatacgcgacaacgcctgccaaatggttcggcctagaattctccgaggtgactctt
gaaaccgttccaattctattcaatgagatcccggcgttaccgatcactgaaagacaacgt
taa

DBGET integrated database retrieval system