KEGG   Lactobacillus plantarum WCFS1: lp_0527Help
Entry
lp_0527           CDS       T00115                                 

Gene name
carA
Definition
(RefSeq) carbamoyl-phosphate synthase small subunit
  KO
K01956  carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00240  Pyrimidine metabolism
lpl00250  Alanine, aspartate and glutamate metabolism
lpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    lp_0527 (carA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lp_0527 (carA)
Enzymes [BR:lpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     lp_0527 (carA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_sm_chain GATase Peptidase_C26
Motif
Other DBs
NCBI-GeneID: 1061839
NCBI-ProteinID: YP_004888531
UniProt: O08317
Position
complement(475630..476697)
Genome map
AA seq 355 aa AA seqDB search
MNKYLTLADGTQWIGTAIGDCQLEAAGRIVFNTGMTGYQETLTDPSYLNQMIAFTYPLIG
NYGIDPTVAQAPTIGAQAIIVHELATFNDHYTSRQSLASFLTIHHVAGIEGVDTRDLTIH
IRQTGAQMAILSNHPITDFEAQLATFAPQVLTATPLPVATTTIRPRVAILNFGEKAAITA
ELQARGADVVVLPPTASLKAVAAYHPDGILLSNGPGDPTDYHTYLATIRQLAQRYPLAGI
CLGHQLIALAYGAQTYQLSFGHHGLNHPVQACADGRIIMTSQNHDYAVDPASIKGTPLIV
THTELNDGSIEGLRLPHQAVMSVQFHPEAHPGPQEAGQFFDDFLLTIQKEAVVNA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatacttaactttagcagacggcacacagtggattggaacggcaattggggat
tgccagctagaggctgcggggcgcatcgtcttcaatacgggaatgacgggttatcaggaa
acattgactgatccatcctacctaaatcaaatgattgccttcacttacccattaattggt
aattatggtatcgatccgaccgtggcccaggcaccaacgattggcgcacaagccatcatc
gttcacgagctggccacttttaatgatcactatactagtcgccaatcactggcaagtttt
ctgacaatccaccatgtagccggcattgaaggcgtcgatactcgtgacctaacgattcac
attcgccaaacgggagcccagatggcaatcttgagcaatcatcccatcactgattttgaa
gcgcaactcgccacattcgcaccccaagtactaacggctacccccctcccagtagcgacg
accaccatccgtccacgcgtcgcgattctcaactttggtgaaaaagcagctatcaccgct
gaattgcaagcccggggcgcggacgttgttgtccttccacctacagctagtctcaaggcc
gtggccgcgtatcaccctgacggaattttgttatccaacggtcccggtgatccgactgac
tatcacacttacttagcgaccattcgccaactcgcacaacgttatccgctggctggcatt
tgccttggtcatcagttgatcgcgctcgcctatggtgctcagacttaccagctttccttt
ggtcaccacgggctaaaccatccggtacaagcctgcgctgacggtcgtattatcatgact
tcgcaaaatcatgattacgccgtcgatccggcatcgatcaagggcaccccgctgatcgtc
acgcacactgaattaaatgacggcagcattgaaggcttgcgcctaccgcaccaggccgta
atgtcggtgcaattccatcccgaagcacacccggggccccaggaagctgggcaatttttc
gatgatttcttactaacaattcaaaaggaggcggttgttaatgcctaa

DBGET integrated database retrieval system