KEGG   Lactobacillus plantarum WCFS1: lp_0533Help
Entry
lp_0533           CDS       T00115                                 

Definition
(RefSeq) transport protein, QueT family
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueT
Motif
Other DBs
NCBI-GeneID: 1061874
NCBI-ProteinID: YP_004888537
UniProt: F9UL08
Position
482282..482788
Genome map
AA seq 168 aa AA seqDB search
MTQSKIRPWIINALVAAMYVVLCLGPAAFSLASGAIQFRVSEGLNHLAVFNRKYIWGIVA
GVILFDAFGPGASLLNVLFGGGQSLLALLVLTWLAPKLKTVWQRMLLNIALFTVSMFMIA
LMITMMSSGVAFWPTYLTTALSELIIMSITAPIMYSLDRVLHFSDRIQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatcaaaaattcgaccatggattatcaacgccctagtcgctgcaatgtatgtt
gtattatgcctaggccccgcagcttttagcttggcatcgggcgcaattcaattccgcgtt
tctgaagggttgaaccacttagccgtgttcaatcgcaagtatatttggggaattgttgct
ggcgttattttgtttgacgcttttggtcccggtgcgagtctcctcaacgttctctttggt
ggcggccaatcattattagccctgctggtattgacgtggttggcccctaagttgaagacg
gtttggcaacggatgttactgaatatcgcgctattcaccgtttcgatgtttatgatcgca
ctgatgattaccatgatgagtagcggcgtcgctttctggccgacgtatctaacaactgct
ttatcagagttgattatcatgagtatcaccgcgccaattatgtacagcttggatcgggtc
ttgcactttagtgaccggattcagtag

DBGET integrated database retrieval system