KEGG   Lactobacillus plantarum WCFS1: lp_0537Help
Entry
lp_0537           CDS       T00115                                 

Gene name
ldhL1
Definition
(RefSeq) L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00010  Glycolysis / Gluconeogenesis
lpl00270  Cysteine and methionine metabolism
lpl00620  Pyruvate metabolism
lpl00640  Propanoate metabolism
lpl01100  Metabolic pathways
lpl01110  Biosynthesis of secondary metabolites
lpl01120  Microbial metabolism in diverse environments
lpl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_0537 (ldhL1)
   00620 Pyruvate metabolism
    lp_0537 (ldhL1)
   00640 Propanoate metabolism
    lp_0537 (ldhL1)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    lp_0537 (ldhL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpl04147]
    lp_0537 (ldhL1)
Enzymes [BR:lpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     lp_0537 (ldhL1)
Exosome [BR:lpl04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   lp_0537 (ldhL1)
  Exosomal proteins of breast milk
   lp_0537 (ldhL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C UDPG_MGDP_dh_N NAD_binding_7 ThiF
Motif
Other DBs
NCBI-GeneID: 1061886
NCBI-ProteinID: YP_004888540
UniProt: P56512
Position
complement(485467..486429)
Genome map
AA seq 320 aa AA seqDB search
MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTA
PKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDGIFL
VAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHG
DSEFAAYSTATIGTRPVRDVAKEQGVSDEDLAKLEDGVRNKAYDIINLKGATFYGIGTAL
MRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAVIGGTGLKQIIESPLSADELKKMQ
DSAATLKKVLNDGLAELENK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaagcatgccaaatcatcaaaaagttgtgttagtcggcgacggcgctgttggttct
agttacgcttttgccatggcacaacaaggaattgctgaagaatttgtaattgtcgatgtt
gttaaagatcggacaaagggtgacgcccttgatcttgaagacgcccaagcattcaccgct
cccaagaagatttactcaggcgaatattcagattgtaaggacgctgacttagttgttatt
acagccggtgcgcctcaaaagcctggtgaatcacgtttagacttagttaacaagaattta
aatatcctatcatccattgtcaaaccagttgttgactccggctttgacggcatcttctta
gttgctgctaaccctgttgacatcttaacttacgctacttggaaattctcaggtttccca
aaggatcgtgtcattggttcagggacttccttagactcttcacgtttacgcgttgcgtta
ggcaaacaattcaatgttgatcctcgttccgttgatgcttacatcatgggtgaacacggt
gattctgaatttgctgcttactcaactgcaaccatcgggacacgtccagttcgcgatgtc
gctaaggaacaaggcgtttctgacgaagatttagccaagttagaagacggtgttcgtaac
aaagcttacgacatcatcaacttgaagggtgccacgttctacggtatcgggactgcttta
atgcggatttccaaagccattttacgtgatgaaaatgccgttttaccagtaggtgcctac
atggacggccaatacggcttaaacgacatttatatcgggactccggctgtgattggtgga
actggtttgaaacaaatcatcgaatcaccactttcagctgacgaactcaagaagatgcaa
gattccgccgcaactttgaaaaaagtgcttaacgacggtttagctgaattagaaaataaa
taa

DBGET integrated database retrieval system