KEGG   Lactobacillus plantarum WCFS1: lp_0539Help
Entry
lp_0539           CDS       T00115                                 

Gene name
mfd
Definition
(RefSeq) transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    lp_0539 (mfd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpl03400]
    lp_0539 (mfd)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     lp_0539 (mfd)
DNA repair and recombination proteins [BR:lpl03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      lp_0539 (mfd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CarD_CdnL_TRCF TRCF Helicase_C DEAD ResIII UB2H IstB_IS21
Motif
Other DBs
NCBI-GeneID: 1061882
NCBI-ProteinID: YP_004888542
UniProt: F9UL13
Position
487338..490865
Genome map
AA seq 1175 aa AA seqDB search
MDIETIVEQTPDFQTILAGISPRSRQLITGLNGSARTVYLSALFHQLTHSLLIVTDNGFH
ASQLVDDLTSLLDEDQVFLFPAEEMIATEVATSSPESRAQRVQALNALLRDSPAVVVTSV
AGARRFLPPVAQFQAATLPVAVGQDIDLEDLQRQLHDMGYVKEKLVARPGDFAVRGSIVD
IYPLDADYPLRLDFFDTEVDTLKYFDPETQRSVENLDEYTILPATDFILTSAMLQAGAQR
LKTAIAAENKKLKPAERQTLADNLAQPLADMEKGIIGNDLLLYGDYLYDRKTSIFDYVAA
DGLVIFEEYSRLLDSEQQLLTQEADWVTDQLAHHRVLATASYGNDIRDLLRDDQHAQLLI
SLFQKGIGNVKLAQVTNVRTRPMQEFFGQLPALKTELDRWHKLKQTVVLMVSEAERLTKV
SDTLDDFEIEAVMTKATNLQPGAVQIVQGSLQNGFEFPDGKLVIVTEQEMFKKVAKKRPR
RQTLANAERLKSYTDLKPGDYVVHVNHGIGKYVGMETLEVDGVHQDYITIAYQNNAKIFI
PVTQLNLVQKYVSSESKTPRINKLGGTEWTKAKRKVAAKIEDIADELVDLYAKREAEKGY
AFPPDDSYQDDFDNDFPYPETPDQIRSINEIKHDMERPKPMDRLLVGDVGYGKTEVALRA
AFKAIEAGKQVAFLVPTTILAQQHYETMLNRFEGYPINVGMLSRFRTTKEMKETVQQLKS
GEIDIVVGTHRLLSKDVAFADLGLLIIDEEQRFGVKHKERLKALKASVDVLTLTATPIPR
TLHMSMLGVRDLSVIETPPTNRYPIQTYVMEQNFGVIKEGIEREMQRNGQVFYLHNRVHD
IDKVVAQIKDLVPDAAVAHIDGQMPESQLEGILYDFIRGEYDVLVTTTIIETGVDIPNVN
TLFVENADRMGLSQLYQLRGRIGRSSRVAYAYFTYQQNKVLTEVGEKRLQAIKDFTELGS
GFKIAMRDLSIRGAGNLLGKQQHGFIDSVGYDLYTQMLSEAVAKKRGQAAKVKTDATVEL
GIEAYLPTSYIEDERQKIEIYKRIRQLENNDQYMEVQDDLMDRFGDYPVEVAGLLAVGKL
KLLADDALIEKIQRDDSELHLTLSKQGTAKLDTKDIFKALAKTKLKATVGIDDDKMKVKL
VIQPKMQQDEWLAQLTQFVEQLSLILAEDDVASAS
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atggatattgaaacgattgttgagcaaacgcccgactttcaaacaattttagcaggtatc
agcccgcgtagtcggcaactaatcaccggattgaacggttcggcacgaacggtttattta
agcgcgctatttcaccaattaacgcattcattactgatcgtgaccgataacggttttcac
gcgagtcagctagtggatgatttaacgagtctcttagatgaagaccaagtttttttattc
ccagctgaagaaatgattgcgacggaggttgcgacaagttcaccagagtcacgagcgcaa
cgagtccaggctttaaacgccttattgcgtgacagtccggcagtggtcgtgacctcggtt
gcaggtgcccggcggttcttgccgcccgtcgcacaatttcaagcagccacgttaccggta
gccgttggtcaagatattgatttggaagacttgcagcggcaactacacgacatgggttac
gttaaggaaaagttagtcgcacgcccaggagattttgcggtacggggctcaatcgtggat
atttacccgttagatgcggactaccctttacgactggacttctttgatactgaagttgat
acactgaagtattttgacccggaaacgcaacgttcggtggaaaacttggatgagtatacg
attttaccagctaccgactttatcctaacatcagctatgctgcaggccggggcacagcgt
cttaaaacggcgattgcggctgaaaataagaaactcaagccagccgaacgccagactttg
gccgataatttagcacaacctttagctgacatggaaaaaggaattatcggaaacgattta
ttattatatggcgattatttatacgaccggaaaacgagtatttttgactatgtggccgct
gacgggctcgttatcttcgaagaatattcgcgtttgcttgatagtgagcagcagttatta
acgcaagaagctgactgggttacggaccaattggcacatcaccgggtgctggcaactgcg
agttacggcaatgatattcgggatttgctccgggatgaccaacatgcacaactcttgatt
tcgctgtttcaaaagggcatcggcaacgtcaaactagcgcaagtaaccaacgtgcgcaca
cgcccgatgcaggaattctttgggcagctcccagcgttgaagaccgaactggatcggtgg
cataagcttaaacagacggtggtcttgatggtatcagaggctgagcgtctgacaaaggtc
agtgatacacttgatgattttgaaatcgaagcggtcatgactaaggccactaatttacaa
ccgggggcggttcaaatcgtgcaaggtagcttgcaaaatggatttgagtttccggatggt
aaattagtcatcgtaaccgagcaagaaatgttcaagaaggtggctaagaagcgtccacgt
cgtcagaccttggctaatgccgaacggttgaagagctatacggatctcaaacccggcgat
tacgtcgtgcacgtcaatcacgggatcggaaagtacgttggtatggagacgctggaagtt
gatggtgtccatcaagactacattacgattgcgtatcaaaataatgcgaagatctttatt
cccgtgacccagttaaacctagttcaaaagtacgtttcgtcagaatcaaagacgccacgc
atcaataagttgggtggtaccgaatggacgaaagcgaagcgcaaagtcgcggcgaaaatt
gaagatatcgcggatgaactagtcgacctgtatgccaagcgagaggcggagaaaggttac
gcctttccaccggacgatagttatcaagatgatttcgataacgattttccgtacccagag
acgccggatcaaattcgtagtattaatgaaatcaagcatgatatggaacgaccgaaaccg
atggaccgcctattggtcggcgatgttggttatgggaagacggaagtcgcgttgcgggcc
gcgtttaaggcgattgaggccggcaaacaagtggcctttctagtgccaacgaccatttta
gctcagcaacattatgaaacgatgctgaatcggtttgaaggctacccgattaacgttggc
atgctgtcacgattcagaacaactaaggaaatgaaagagacggtccaacagttaaagagt
ggtgaaattgacatcgtggttggtacgcaccgcttactgtctaaggacgtcgcgtttgct
gatctgggcctgctcattattgatgaggaacaacggtttggggtcaagcacaaggaacga
ctgaaggccttgaaggctagtgtggatgtcttgacgttaacggcaacgccgattccgcga
acattacacatgtcgatgctcggtgtacgggacttatcagtgattgagacgccgccaacg
aaccgttatccgatccaaacgtacgtcatggaacagaattttggcgtcattaaagaggga
attgaacgagaaatgcaacgtaatgggcaggtcttttatttgcataaccgggttcatgat
attgataaagtcgttgcacagatcaaagacttggttcccgacgcggcggtggcccatatt
gatggtcagatgcctgagtcacaactcgaagggattctctacgatttcattcggggtgag
tacgatgtgttagtgacaacgacgatcattgagaccggggttgatattccaaacgtcaac
accttatttgtggaaaatgctgaccggatgggactgtcacagctataccagttgcgtggc
cggattggtcggagtagtcgggtcgcctatgcttactttacttatcagcaaaataaagtt
ttgacagaagttggtgagaaacggttacaggccatcaaggactttacggaacttggatct
ggctttaaaatcgcgatgcgcgacttgtcgattcggggtgctggtaacttgttaggtaag
caacagcacggctttattgactcagttggttatgacctctatacccagatgttgtcagaa
gcagtggcgaagaagcgtggtcaggcggctaaagttaagaccgatgccacggtcgaactt
ggaatcgaagcctacttgccgaccagctatattgaagatgaacggcaaaagatcgaaatt
tataaacggattcgccagctggagaataatgatcagtacatggaagttcaggatgattta
atggatcggtttggtgattatccggtagaagtcgctggactattagcagtaggtaagctg
aagttactggcggatgacgcgctgattgagaagattcagcgtgacgatagtgagctacac
ctaacgttatccaaacaagggacggctaagctagatactaaagatatttttaaggccttg
gcaaaaacaaaattaaaagcgacagttggaattgatgatgataaaatgaaggttaaatta
gtcattcagccaaagatgcaacaggatgagtggctggcgcaattaacacagtttgtcgaa
caactgagtttgatcttagccgaagacgatgtcgctagtgcgtcttag

DBGET integrated database retrieval system