KEGG   Lactobacillus plantarum WCFS1: lp_0545Help
Entry
lp_0545           CDS       T00115                                 

Gene name
tilS
Definition
(RefSeq) tRNA(Ile)-lysidine synthase
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lpl03016]
    lp_0545 (tilS)
Enzymes [BR:lpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     lp_0545 (tilS)
Transfer RNA biogenesis [BR:lpl03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    lp_0545 (tilS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS_C PAPS_reduct Ish1 tRNA_Me_trans
Motif
Other DBs
NCBI-GeneID: 1061899
NCBI-ProteinID: YP_004888547
UniProt: Q88Z33
Position
494395..495741
Genome map
AA seq 448 aa AA seqDB search
MTPIQKFNRQLAAAKLLSPQQTVVVAVSTGVDSMVLLHLLQRLPAAERPRVVVAHVNHHL
REQSQMEADYLRQYCQQQNLKLVMADWLPAAHPKSGIEAAGRQFRYHVFAKVMRENRATA
VLTAHHANDQVETYLMKLARGGDISQLTGIATSRPFATGRLIRPLLTWSKDQLRNYAAEQ
HVVYFEDVTNQDVALTRNRIRHRVVPELMTVNPQLLKHVADYQQQLTTLLTAKKQMVTVL
LSQVVTATGALVVDQWGALPSQWQLAVFATWLEQQTQQLFTESKLQPLVSWGQRTRPATS
RLTVNAAWELYRNAGIIEALPIKKRGKKLMPREKIMVDLNQWQKITATQTVGIFTRVPNV
VSQPFWLTEADWPLVWRPWQAGDRIVLKGGGHQLVRRLLIDRKVPAERREQVQVLVNAQG
NVLWVVGHKFSYRTTGTQTVFLALKHES
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacaccaattcaaaagttcaatcggcaattagctgcagccaaactgttatcaccacag
caaacagtggtggtagcggtgtcgactggggtcgattcaatggtattgttgcatttgttg
caacgattgccagcagcggaacggccacgggtagtggtggctcatgttaatcatcattta
cgcgaacaaagtcaaatggaagcggactacttgcgacaatattgccagcagcaaaacttg
aagctagtcatggccgattggctacccgcggcacatcccaagagtggtattgaagcagct
gggcgtcagtttcggtaccatgtttttgctaaggtgatgcgggaaaatcgtgcaacggca
gttttgactgcgcaccacgccaatgatcaagtcgaaacgtatctgatgaagcttgcgcgt
ggtggcgacatctcacaattgacaggaatcgcaactagtcggccctttgcaacgggccga
ttaattcggccgttgttgacgtggtcgaaagatcagctacgaaactatgctgccgagcag
catgtcgtttattttgaagacgttactaatcaagatgtggccttgacccgtaatcggatt
cggcaccgtgtcgtgccagaacttatgacggttaatccccagttattaaagcatgtggcc
gattaccagcaacagttgacaacgctgttgacggctaaaaagcaaatggtcacggtacta
ctgtcgcaggtcgtaacggccacaggggcgttggttgttgatcagtggggcgcactcccg
agccagtggcagttagccgtttttgcgacgtggctcgagcagcagacgcaacaattattc
accgagtcgaagttacaaccgctggtctcgtggggacaacggacgcggcctgccacgagt
agattaacggtaaacgcggcctgggagttgtaccgtaacgctggtatcattgaagctttg
ccaataaaaaaaaggggtaaaaagttaatgccccgtgaaaaaattatggtagacttaaac
caatggcagaaaattactgcaacccaaacggtgggaatctttacgcgggtgccaaatgtt
gtcagtcagccattttggttaacagaagccgattggccgctagtgtggcggccgtggcaa
gctggtgatcgaatcgttctcaagggcggtggtcatcagctggtacgtcgactgctgatt
gatcgaaaagttccggctgaacggcgtgaacaggtgcaagtgttagtgaatgctcaaggg
aacgttctgtgggtggtcggtcataagtttagctatcgtacgactggtacccagacagta
tttttagccttaaaacacgagagttga

DBGET integrated database retrieval system